CAZyme Information: MGYG000001871_00471

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae
• CAZyme ID: MGYG000001871_00471
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000001871_2|CGC3	43223.91	8.7575

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001871	2601956	MAG	Denmark	Europe

• Gene Location: Start: 160127; End: 161287 Strand: +

Full Sequence      

MKYFLIAGEASGDLHAAQLIGELRRQDATAEFSFFGGDMMAQSACVAPLIHYKDMAFMGF
IEVLKHLSQILGFLEKAKRHIDEWHPDAVILVDYPSFNLKVAKYAYENRIPAFYFISPKV
WAWKEYRVKQIKKYISELYSILPFETEFYASHGYAVEYVGNPTVKEIVTAAKQFADDASF
KAANGLDGDKEIIAIVPGSRHKEIRDNLPEMVAACSKFGQYQAVIAGAPNIDENEYRKIL
NNCGDYGRGIKILFGKSWELVAHSRAAVVTSGTATLETAILGTPQVVCYRMNGSKRVYNW
YKRLLKVKYVSLPNLIADAPVVVELLLHYCNRESIGSELGLLLADTPRRKAVLDGYAKMR
DRLGTNDCAATAAYKLVKKLESSANK

Enzyme Prediction     

No EC number prediction in MGYG000001871_00471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	363	1.6e-108	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.34e-110	1	379	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	8.78e-98	1	373	2	372	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.38e-76	4	370	2	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.19e-64	5	373	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.96e-47	1	335	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64292.1	2.39e-124	1	380	1	374
AHF12800.1	4.33e-121	1	380	1	373
QCD36425.1	1.17e-120	1	383	1	377
QQR08529.1	4.58e-119	1	373	1	367
ASB37800.1	4.58e-119	1	373	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.13e-34	5	366	11	368	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.66e-34	5	366	11	368	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C1F718	1.97e-69	4	372	8	380	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q1D393	7.77e-64	2	373	6	371	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q3JAC1	2.41e-63	5	364	10	363	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q2LVL8	3.33e-62	5	373	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1INL4	4.56e-62	1	377	2	374	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001871_00471.