CAZyme Information: MGYG000001871_00520

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae
• CAZyme ID: MGYG000001871_00520
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
280		32054.02	7.5017

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001871	2601956	MAG	Denmark	Europe

• Gene Location: Start: 226261; End: 227103 Strand: +

Full Sequence      

MYTVAVIVLNYNSSSDCRKCVSFLKKQRGVELEIVVVDNCSRTDDVEQLRQLCNEQDCTL
IENHENRGYNAGNNIGLRYAAEKGYKYALIANPDMEFPQEDYLARIVAKMEEDSNIAVLG
TSIVDAKGLCQNPLDFVSFWSEFLWPIEMLKYKKSHKSLSTVIGCTQSGYCHIVSGCCFC
IRMSFAKQIGFFDENVFLYCEEPILAHQVKVAGMKEYYMSEVMAIHKHISSTKGNPHARM
ILLCKSRDYKNKYHSDYNTFQVMLLRLSSDLRKAVMKIIS

Enzyme Prediction     

No EC number prediction in MGYG000001871_00520.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	146	7.2e-19	0.8176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	5.46e-43	1	280	2	277	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	5.31e-38	6	228	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	4.25e-19	5	197	1	174	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam00535	Glycos_transf_2	1.96e-16	6	124	2	117	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04185	GT_2_like_b	2.60e-13	6	151	1	134	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58693.1	3.66e-142	4	278	3	277
ACX74576.1	1.03e-34	4	267	5	262
ADL25703.1	1.08e-34	4	267	7	264
CDG65201.1	1.19e-31	6	268	5	276
AJQ26040.1	3.89e-30	1	228	1	227

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU63	1.00e-15	4	267	20	260	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P36667	4.58e-06	4	226	2	219	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001871_00520.