CAZyme Information: MGYG000001873_01400

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia
• CAZyme ID: MGYG000001873_01400
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000001873_143|CGC1	83936.47	6.0163

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001873	2665919	MAG	Denmark	Europe

• Gene Location: Start: 2550; End: 4787 Strand: -

Full Sequence      

MARKKATTSAVTPEAPVETATVEVKEAPAAEKPVKEPKAAEVKKEEANAEPVKEEKPKAK
RAAKTAKAAKAVEEAEEPKEKAAKTAKAEEPKEKAAKTAKAEEPKEKAAKTVKAEEPKEK
AAKTVKAEEPKKKAAKTTKADKAEEPKAEEPKAEAVKAETEVKAEEPVKEEKPKAKRAAK
PAKAAEPKEKAAKTTGTRKTKAAAAAEEVKAEEPKAEPVKEVKSEEPKAEPIKEVKAEEP
KAEAIVEEAKAVEEPTYEVYTTPRRSIAFIGSECYPFVKTGGLGDVMYALPKALVKQNCD
VKVILPRYKCIPWKYQEKMVYRGSFEMDLCADGRSFYVGIMEYVWDGVVYDFIDNEEFFS
SGNPYTNLIDDIPKYCFFAKAALAALSYMDWTPNIIHCHDWQAALVPVYLRTLFETSKLS
SAKTILTIHNLRFQGVYNIPTIRYWSGLPDYVFNKDALKEGYQDANMLKGGLTYSNIITT
VSNTYAWEIQTPYYGENLDAHLRYHSGKLRGIVNGIDYDIWNTATDERLYVNYDITNVLE
KKKENKRRLQEELGLEQDDHKFVIGLISRLTNQKGLDLINAIIPQIMDEHTQIVVLGTGD
AMYEDSFRYYENAYKGNICSNIMYDETRAHRIYAGADAFLVPSQFEPCGLTQLIAMHYGT
VPIVRETGGLKDTVEPYNMFTNTGNGFTFDNYDAGLLLDAINRAKTLYFTNRWCWDEMVQ
RDMDKNFSWDNSAKQYKDLYLELTW

Enzyme Prediction     

No EC number prediction in MGYG000001873_01400.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	267	740	1.9e-177	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	267	740	3	475	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	267	743	3	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	267	742	2	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	267	743	3	463	glycogen synthase GlgA.
PRK14099	PRK14099	3.79e-110	262	744	2	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH27847.1	1.53e-292	263	744	265	746
QUC04956.1	3.03e-282	264	744	24	505
SDR77824.1	5.63e-276	264	744	269	750
BCL59191.1	2.81e-272	252	744	172	663
CBL39792.1	2.35e-266	246	744	64	558

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	1.77e-86	267	743	3	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	6.08e-86	267	743	3	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	4.55e-85	267	743	3	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	8.89e-84	267	740	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	1.52e-79	265	740	125	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z0G2	4.08e-172	265	743	2	478	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1
A9KMA3	3.51e-162	265	743	2	478	Glycogen synthase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=glgA PE=3 SV=1
B2V049	6.29e-136	267	745	3	477	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
Q97GX6	2.42e-135	267	743	3	476	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
B2TR28	7.01e-135	267	745	3	477	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001873_01400.