CAZyme Information: MGYG000001873_01605

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Marvinbryantia
• CAZyme ID: MGYG000001873_01605
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816		91516.44	6.1261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001873	2665919	MAG	Denmark	Europe

• Gene Location: Start: 251; End: 2701 Strand: -

Full Sequence      

MRKEAFNENWICYQTGKKETALAVSLPHDAMLLDERRQGCAGGVNNGWVDAKDYTYEKSF
TAPEEWREKETVFYFEGVYRKATVYLNGEKVCYHDYGYTGFFVDVTGKLRYGAENVLTVT
AINSDQPNSRWYSGTGIYRPVWLYTLPKQHICLQGIRITTLDYKNPKIRVRVQTNGSGSV
KVEILEAGERQNEIREKAVDMQPDGGGENADAQILRETQGTTDGNFVCDLELPGAKCWST
EQPELYACRVTFGEDVCEERFGIRIVKCDVQNGFTLNGKRVILRGACIHHDNGILGACAY
DFAEYRKIRLLKEGGYNAVRSAHNPCSETMLRACDELGMLMMDEYTDMWYIHKTKNDYAS
EVEAHYREDLKAIVDKDYNHPSVVMYSTGNEVSETAQKRGIELCGNLTECLHELDGTRPV
TCGVNIFFNFLSSMGFGVYSDKKAEQEVKNAKKKAVGSEFFNNLAGLMGSDFMKFGATLY
PCDVKTRDAFAAMDVAGYNYGIRRYEHDLKKYPKRIIVGSETFCSDAYTFWETAKKHPRV
IGDFVWSGMDYLGEVGVGTWEYKDYAPDFSHGEGWVAAGSGRIDLTGRELAEMTYTRVAF
ELEKIGIGVVPVPYAGQKHSPSAWKMTNAIESWSWRGCAGKKTQVEVYARADHVSLFVNG
KCVGTKKPQGDCRVVFETAYQDGSVRAVAYDAKENVIAEKELKTAGKETILTVKPEQSFV
GREDLCYVRLQFTDREGTLKPMVREDITVQVEGGKLLGIGSACPYYTKNYLGNVTDTYYG
EALAVIRPEEEGTIRVYAKSAHARGSAEIKVCGVGV

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	6	614	8.5e-100	0.6117021276595744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	7.12e-58	47	440	58	447	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.92e-47	53	428	66	452	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.29e-28	56	391	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	2.66e-24	56	391	124	462	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	2.66e-18	46	147	66	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFJ54527.1	0.0	1	811	1	789
QRT30385.1	0.0	1	794	1	779
QHB24152.1	0.0	1	794	1	779
QEI31653.1	0.0	1	794	1	779
BAM48408.1	0.0	6	811	5	785

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	5.63e-118	1	799	5	764	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	3.27e-117	1	799	5	764	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	1.25e-86	5	800	29	808	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	3.54e-84	2	801	8	796	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	1.43e-83	1	811	1	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	7.80e-76	24	787	74	822	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	9.71e-49	24	753	78	758	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.99e-37	3	667	53	676	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	2.21e-27	56	394	114	444	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P05804	1.41e-22	29	428	36	448	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001873_01605.