CAZyme Information: MGYG000001874_00772

Basic Information

• Species: QAMI01 sp900554095
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; QAMI01; QAMI01 sp900554095
• CAZyme ID: MGYG000001874_00772
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000001874_10|CGC2	38142.04	8.2037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001874	2081057	MAG	Denmark	Europe

• Gene Location: Start: 30076; End: 31092 Strand: -

Full Sequence      

MFNIPLANVLKANGYTVDWIVSEKGYEIVKDNPCVNKVYLAPVQKWKKRGLSIVSFFEYL
KILREIRKEHYDIAIDCQQMFKSMYWMIFSGAKRRLASENAKEFSHLGANEIVPNIYGGY
ERHSVLNNLKYAEYLGLNTEKIEFTLPETSAQAKAKIDKLLEHTDKTKPLVVIAPATTWE
LKHWSKDNWKEVVEGIKDECSLVFTGTEADSGLLKYIGADNYTNLCSKTKLEELRELLSR
ADIVLAPDSGSAHLAWASGKPAVIAIFTCTPPGMFGPFDYGENKGKYFAVNGGLDCQPCF
SINCPKLDENKNLCQRIPTAQKIINIVKNLLKNQTPTL

Enzyme Prediction     

No EC number prediction in MGYG000001874_00772.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	61	306	6.5e-45	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	7.98e-42	10	333	25	332	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.17e-40	1	329	14	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	5.19e-35	60	305	2	242	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10964	PRK10964	4.58e-11	17	283	33	293	lipopolysaccharide heptosyltransferase RfaC.
TIGR02195	heptsyl_trn_II	1.25e-08	28	305	43	310	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38472.1	2.93e-126	1	333	16	348
CBX29924.1	1.03e-37	17	329	37	346
AEH45178.1	1.31e-37	4	324	18	331
ADO76416.1	2.08e-36	4	331	24	349
ADQ15545.1	3.63e-36	17	321	39	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	1.90e-14	14	284	30	294	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	1.90e-14	14	284	30	294	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	2.02e-14	14	284	30	294	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26469	2.10e-14	14	284	30	294	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
P24173	2.91e-14	14	284	30	294	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
Q57336	1.93e-11	19	330	43	344	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001874_00772.