CAZyme Information: MGYG000001876_00667

Basic Information

• Species: Acetatifactor sp900760705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900760705
• CAZyme ID: MGYG000001876_00667
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000001876_11|CGC1	42783.59	4.8131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001876	3172346	MAG	Denmark	Europe

• Gene Location: Start: 22203; End: 23309 Strand: -

Full Sequence      

MEQKERTQWKPLDYARAACDTMMRKFKPEDLPPKGHFHYHQGVFLSGVYQTYVLSQEEKY
YQYMKDWVDYEINDKGEIREYDKGQLDDIQPGILLFPLYKRTGEEKYKKALDTLLPIIRD
FPRNEAGGFWHKEWYPNQMWLDGLYMAGPISAEYAYRFEKPEYLDLAAEQALLMQEKTRD
PKTGLWYHAWDSSKEAEWADPETGLAPEFWGRSIGWVPVAVLDELDFMPREHKDHEALWM
LVQNLLLAVLNYQSEEGRWYQVVNKGDQPGNWLENSCSCLFVAAICKAVRKGILEAKYLE
AAKKGYYAVINSLEWDGENLLLGGVCVGTGVGDYKHYCERPVSVNDLHGMGAFLLMCAEA
QRALDEFQ

Enzyme Prediction     

No EC number prediction in MGYG000001876_00667.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	32	361	2.1e-108	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.25e-106	4	364	1	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.30e-96	14	364	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92567.1	3.89e-172	12	365	6	360
ATO42094.1	3.55e-161	11	362	6	358
AFU70692.1	3.55e-161	11	362	6	358
QNK55786.1	7.33e-157	11	363	10	363
BCJ93957.1	1.53e-156	11	363	9	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	7.28e-108	11	361	13	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.00e-107	11	361	3	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	5.12e-77	14	359	4	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	1.34e-22	42	343	70	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.61e-20	42	343	71	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.99e-107	11	361	13	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	9.83e-25	146	360	1	228	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	9.83e-25	146	360	1	228	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	2.94e-24	42	359	34	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001876_00667.