CAZyme Information: MGYG000001876_00835

Basic Information

• Species: Acetatifactor sp900760705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900760705
• CAZyme ID: MGYG000001876_00835
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		49587.56	4.2069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001876	3172346	MAG	Denmark	Europe

• Gene Location: Start: 20012; End: 21328 Strand: +

Full Sequence      

MTTFPSELKISKTEEQRGTVDQNEETIDAPYAGKLQVSVTSAIGMFPVEGANVKIASTGD
PQNQISELETDESGQTKVLDLQVPPLNWSLDPETLEQPYAEYNIEVTAKGYETVYVSGVQ
VFADQLALQQIRINPLETTEEEEKRVIIPVHTLFGEYPPKIPEEEIKDIPETGEIVLSRV
VIPEYVIVHDGVPQDSTARNYWVRYKDYIKNVLSCEIYATWPEAAIYANALVVMSFTLNR
VYTEWYRNQGYDFTITSSTAYDQKWVYGHNIFENIDYLVDTIFANYLSRPGVRQPIFTSY
CDGNRVSCDGLSQWGSKYLAEEGYTPIQIIRYYYGNDMFINTAEAISGIPSSWPGYDLKV
GASGEKVRQLQVQLNRIARNYPAIPTISPDGIYGEATEEAVRTFQKIFKLPQTGVADYPT
WYEISEIYVGVTRIAEPD

Enzyme Prediction     

No EC number prediction in MGYG000001876_00835.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	1.66e-13	363	421	1	54	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	3.35e-08	358	421	39	99	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	2.39e-07	316	424	52	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	1.34e-05	280	334	198	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
pfam08486	SpoIID	0.001	207	268	15	72	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT31086.1	2.02e-193	20	436	16	430
QEI32542.1	1.08e-192	20	436	14	428
QHB25032.1	1.08e-192	20	436	14	428
QRT50293.1	1.31e-188	33	436	13	417
QUO33025.1	1.85e-183	28	436	7	416

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001876_00835.