CAZyme Information: MGYG000001876_00839

Basic Information

• Species: Acetatifactor sp900760705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900760705
• CAZyme ID: MGYG000001876_00839
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556	MGYG000001876_15|CGC2	62604.04	4.8507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001876	3172346	MAG	Denmark	Europe

• Gene Location: Start: 25413; End: 27083 Strand: +

Full Sequence      

MTMEKLKKQGREVLTKRVTLEPVKVLWKQGEVENEQMLLERRSRQISLVASSPVVMKTTS
EQQASVLLDYGTEIHGGIRILVWGEGTGKGAKVRVRFGESASEAMAKIGGEDNATNDHAR
RDLVTEVGMMSMNPIGETGFRFVRLDLLEETTLALKAVTAELVYKDVPYRGSFRSSDDLL
NKIWETGAYTVHLNMQEYIWDGIKRDRLVWVGDMHPETLTIRSVFGADDAVERSLDFIRE
ETPLPGWMNTMAAYSMWYVIIVYDWFLYTGHLDWVKTQADYLKGLSDQLSEHIDSEGKDT
VTQGRFLDWPSNDNPVVTDAGVQAIHYLAADSLEKLFEALGEKEYAERCAEDKKRLVRYE
TDYQEAKQAAALLVLAGLKDADKVNEELLQKNGAAGMSTFMGYYILAARAAAGDYTGCLE
SIREYWGGMLKLGATTFWEDFDVEWMKNAAPIDRLPEEGEVDVHKTYGRYCYQGYRHSFC
HGWASGATAWMSEYVLGVKILEPGCKKVKITPHLGDLDWVEGTYPTPLGEIHIRAEKTAE
GTRVCINAPEGVTVTE

Enzyme Prediction     

No EC number prediction in MGYG000001876_00839.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	62	555	8.9e-103	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.30e-13	171	495	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.59e-05	497	555	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBM20341.1	2.25e-209	6	549	10	559
QGQ98689.1	5.40e-209	22	554	19	556
BBH21551.1	1.90e-201	17	554	14	555
ATP57578.1	7.57e-200	17	554	41	582
QMV41231.1	1.59e-195	17	554	12	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.37e-50	41	533	169	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	5.74e-14	65	496	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001876_00839.