CAZyme Information: MGYG000001876_01900

Basic Information

• Species: Acetatifactor sp900760705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp900760705
• CAZyme ID: MGYG000001876_01900
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669		76310.23	6.3141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001876	3172346	MAG	Denmark	Europe

• Gene Location: Start: 17641; End: 19650 Strand: +

Full Sequence      

MNSFLAKERLTGEVIVLSQKENGCELELGKRGGGIEIPEFLHRTERYFTFHVKACEEHSL
ALHLLIYGKDPKEPQMTIRFGILPDMDTLMCIDREWFDAKELFPENLPGELKIVCHGRRI
EQAEISKVVLAVLPAWHHVRIALKDFAFTDTLPKVTLTKEKLVDVFGQNKRKEWPGKIRT
QEELKEKLRVQLSEKDGAYPFSDWSVYGGFTGKKLTEGTGFFGKKKEENGTWWLTDPLGN
AFLSVGPDCVGAGIDCRIDGLEKNLDWLPEKKDPEYGGFFGPKRKFKKPGSKRKFQCFSY
SEANLYRAFGAEWKSDWQAMMVGQLKKHGMNTLGNWSDPALFGTTGIPYVTSLPKFPDTK
QFIFRDFPDVFSEEYERNSGKCAEALKARADDPWMIGYFLRNEPSWAFVDNLVLADEVLY
NPAETCCKTELIHRLEEKYHTIKALNRAWKTDFAGFEDLRLSQKEISKRSKAAREDMRSF
SKEMLGRYVEIPSRACRQADPNHMILGMRWAWISDPDLVTGWENFDVFSINCYAVDPTDA
IQNIVNLGVDLPVMIGEFHFGALDAGPSATGLEGVPSQHDRGTAYRFYCEKAVAHKNGVG
CHYFQCYDQFCLGRFDGENYNIGLFDICSQPYPDMMEQVKLCSSEMYLVADGKKEAVKEH
APSIPMIAY

Enzyme Prediction     

No EC number prediction in MGYG000001876_01900.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	117	647	1.8e-116	0.8407350689127105

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	0.009	372	453	105	176	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEU47593.1	1.68e-239	17	669	16	658
QFR24656.1	4.78e-239	17	669	16	658
QFR63110.1	6.78e-239	17	669	16	658
QGG55910.1	2.59e-189	22	669	21	669
AZP03585.1	5.19e-189	13	669	12	669

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z6P_A	1.31e-55	120	647	180	759	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
4BQ2_A	1.98e-52	118	654	159	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	5.04e-52	118	654	159	750	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	2.04e-49	125	647	185	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	3.98e-55	160	649	429	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	4.06e-47	161	647	397	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001876_01900.