CAZyme Information: MGYG000001878_00047

Basic Information

• Species: Parabacteroides sp900548175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900548175
• CAZyme ID: MGYG000001878_00047
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000001878_1|CGC1	45535.64	6.3643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001878	3414068	MAG	Denmark	Europe

• Gene Location: Start: 55454; End: 56662 Strand: -

Full Sequence      

MKNFLLLCVLSTVGLLLSACTSEPKEEPIGSVIERGLKSATDQALLMAKELENQEGKLPK
SMKDGKLETSDYSWWCSGFFPGELWYLYEANPTPELKRYAELYTARVEKAKTITNNHDVG
FMLNCSYGNGYRLTGNPKYKEVMIEGAHSLATRYNPQLGLMRSWDSDKQKWQYAVIIDNM
MNLEFLMWAGRATGDSTFTQMAISHADKTMANHFRPDYSSYHVVSYDTITAQPHIKQTHQ
GYADESAWARGQAWALYGYTMMYREAKKQAYLEQANHIAQFLMNHPNMPADKIPYWDFDC
PDIPHTVRDASAAAIMASALIELSQFNPNDFGKQCLSFAEQQIRSLTSPAYLATPGTNAN
FAIMHCTGHLPGNSEVDVPLSYADYYYVEALLRLRNVLNFGR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	69	394	8.3e-128	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.46e-13	75	302	29	247	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50637.1	9.28e-210	1	398	1	398
QJR58403.1	3.80e-173	1	399	1	394
QJR71294.1	3.80e-173	1	399	1	394
AII67843.1	3.80e-173	1	399	1	394
QJR66954.1	3.80e-173	1	399	1	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	8.90e-112	56	397	53	391	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	9.80e-46	68	393	61	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.00e-45	68	393	62	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.40e-45	68	393	62	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	5.30e-45	68	393	62	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	2.59e-99	75	398	77	398	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	2.70e-45	64	393	56	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	5.48e-45	68	393	62	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	5.91e-43	63	393	58	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	7.21e-43	66	396	33	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000055	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001878_00047.