CAZyme Information: MGYG000001878_01533

Basic Information

• Species: Parabacteroides sp900548175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900548175
• CAZyme ID: MGYG000001878_01533
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000001878_25|CGC1	78178.71	5.0605

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001878	3414068	MAG	Denmark	Europe

• Gene Location: Start: 31015; End: 33054 Strand: -

Full Sequence      

MKRRIALYAASLAVFACSSVQAEEIGFSGNYQNNRQPLLQKEYIELPLGTIRAEGWMEDQ
LLRMKNGMTGHLDQVYEQVMGKRNGWLGGDGDVWERGPYWIDGLLPLAYILDDEELKKKV
QPWIEWSLASQKEDGYFGPDTDRSYEPGLQRDNAHDWWPKMVMLKIMQQYYSATGDKRVI
QLLTNYFKYQLKTLPESPLGHWTFWGEQRGGDNLMVVYWLYNITGEKFLLELGELIHKQT
FNWTDIFLHQDHLSRQLSLHCVNLGQGFKEPVVYYQQNKDPQQIMAVKQAVKQIRNTIGL
PTGLWGGDELLRFGKPTAGSELCTAVEMMFSLEEMLEITGDVEWADYLERVTYNVLPTQI
TDDYSARQYYQQFNQVNVTRDYREFSTPHEDTDILFGVLTGYPCCTSNLHQGWPKFVQNL
WYATADNGIAALVYGPSQVTAKVADGVGVKIQEETAYPFDEAIHFRVSFTDKSVKEAFFP
FHFRVPGWCQRPVVKLNGKVIDVDLYPGEVARVNRTWKAGDCLTLELPMEVAVSRWYDGG
AVVERGPLLYALKMQEKWEKKSFEADKVVTYGPWYYEVTSDTPWNYALSESSFAPERIQQ
SFIVEKRPSVTGYPWNVENAPISIKTQAKRVKNWTLVRGSAGPVAYYTQMENDTEGEETI
ELIPYGCTTLRIAEFPVRR

Enzyme Prediction     

No EC number prediction in MGYG000001878_01533.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	317	551	1e-33	0.4312977099236641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.56e-65	84	551	51	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.78e-31	113	552	84	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	1.03e-145	31	677	28	650
QNK64903.1	1.04e-144	12	677	3	644
ALL07583.1	1.10e-144	28	677	25	650
QES88795.1	1.30e-141	29	676	27	650
AMP98056.1	2.04e-141	31	677	28	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	4.41e-22	41	553	24	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	8.15e-21	171	556	252	612	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	6.89e-20	41	553	24	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.03e-10	90	590	69	580	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	1.24e-09	59	550	44	565	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	6.80e-09	59	550	44	565	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000554	0.626543	0.372069	0.000315	0.000268	0.000231

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001878_01533.