CAZyme Information: MGYG000001879_00128

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12650
• CAZyme ID: MGYG000001879_00128
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		64825.73	4.9847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001879	1511900	MAG	Denmark	Europe

• Gene Location: Start: 309; End: 2027 Strand: +

Full Sequence      

MKPRNDVHNPQFERKNVICLNGEWEFAIDMEKIGRDDGIELFKPDAKGFDRRITLPFCPE
SELSGIGEKGFMYSVWYRREIDVSDRAKGKRVILKIGACDYKTTVWVNGEEVGTHLGGYS
SFSFDITDKLTNGKGTIVINAEDDCRKGTQPSGKQSPRAKSFGCLYTRTTGIWQTGSIEL
IPEKHIDNFRIVTDIHSKRAIITGKTTGCGKISANAFYNGEIAASDTSESSGSFALVLNI
SELHLWELGKGELYDLELSFGEDTVKSYFGMREVKIEDGKFLLNGKTVFQRLVLDQGFYP
DGIYTAPSDDAIVNDIKISMAAGFNGARLHEKVFEPRFLYHCDRLGYMVWGEQGNWGYNP
SRPENLHNYAEEWTEVVERDANHPSIVCWCPFNETNPQDSDKWNHDITVKSIYKLTKTLD
PTRPCIDVSGFCHTGGTDIFDVHDYTHDTEIMKNRYLPYVTPWSDDEILLFGGKQKYSGA
PVHVSEYGGIGLSLDNDGWGYNKSAASEEEFIKVYRDITNILLDCPNILGFCYTQLYDVE
QEQNGIYTYEREPKVNIEKIREINTRTAAVEK

Enzyme Prediction     

No EC number prediction in MGYG000001879_00128.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	11	546	1.5e-93	0.5917553191489362

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	6.41e-42	10	442	6	439	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	7.33e-42	13	554	8	582	beta-D-glucuronidase; Provisional
PRK10340	ebgA	8.52e-19	48	423	94	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.19e-16	2	439	42	499	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	1.54e-16	274	554	1	287	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ60389.1	1.47e-203	3	571	5	570
AWP26385.1	2.13e-200	3	571	7	579
ANA78861.1	2.81e-198	3	571	7	579
AVV57223.1	2.81e-198	3	571	7	579
ALS26546.1	4.23e-197	3	571	10	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.05e-79	10	566	32	581	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3K4A_A	1.41e-37	15	554	12	580	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]
4JHZ_A	2.54e-37	15	554	12	580	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]
3LPF_A	2.59e-37	15	554	12	580	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPF_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPG_A Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],3LPG_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],5CZK_A Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12],5CZK_B Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12]
6LEM_B	3.39e-37	15	554	8	576	ChainB, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	1.89e-36	15	554	10	578	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
T2KPJ7	9.51e-29	76	423	106	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
O18835	8.83e-25	9	554	33	615	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
O97524	3.71e-24	9	554	33	615	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
P06760	4.90e-24	15	555	36	613	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001879_00128.