CAZyme Information: MGYG000001879_00270

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12650
• CAZyme ID: MGYG000001879_00270
• CAZy Family: GH31
• CAZyme Description: Sulfoquinovosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		39951.6	4.9029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001879	1511900	MAG	Denmark	Europe

• Gene Location: Start: 74; End: 1114 Strand: +

Full Sequence      

MVEELHALGFKVMLWVVPYVMPCGVKWIREVKYYLNPEWEKHFLRNEDGDPAILDWWNGY
SAVLDFENPDDCEFLDSMLRGLMEDYGIDGFKFDGGTLADFTGDDVINGRFRGSENNAHF
AMQKNIAWNEFGMRYPFHEYKDTFKGGGKPVIQRLRDRGHRWDEDGINTIIPNGLAQGLL
GYPFICPDMIGGGEWSVNIRPDFRIDEELFVRMAQVSVFFPMMQFSWAPWRVLSKENFEI
VKKAAEMHAHLAPEIISEVEKAAKTGEPILRHLEYAYPHRGYQSITDEFLCGEDILVCPV
VTKGTFEKDIVVPSGSWQSEDGIVYNEGVHRVKTPLDKIFYLRKIK

Enzyme Prediction     

No EC number prediction in MGYG000001879_00270.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	1	339	6.7e-56	0.7681498829039812

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	1.77e-107	1	317	63	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	3.23e-37	1	339	326	660	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10426	PRK10426	4.62e-24	2	341	275	617	alpha-glucosidase; Provisional
cd06597	GH31_transferase_CtsY	7.61e-23	1	225	70	287	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06603	GH31_GANC_GANAB_alpha	2.56e-15	171	339	247	416	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS47606.1	1.14e-101	1	344	178	506
BBI31333.1	1.28e-99	1	344	182	513
QHT59803.1	5.41e-97	1	344	179	508
QTH43111.1	3.40e-96	1	346	179	512
QJD86405.1	1.01e-94	1	343	179	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7U_A	1.93e-20	1	330	442	777	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
5F7S_A	3.59e-17	1	332	373	714	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
6JR6_A	5.11e-17	1	317	326	653	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
5I0D_A	5.54e-17	2	330	443	777	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]
4KMQ_A	5.57e-17	2	330	464	798	1.9Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e [Listeria monocytogenes EGD-e],4KWU_A 1.9 Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e in complex with alpha-D-glucose, beta-D-glucose, magnesium and calcium [Listeria monocytogenes EGD-e],5HPO_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with maltopentaose [Listeria monocytogenes EGD-e],5HXM_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with panose [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	2.92e-40	1	336	376	695	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	1.93e-39	1	336	375	697	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
P19965	1.57e-23	46	321	386	652	SITS-binding protein OS=Tetronarce californica OX=7787 PE=1 SV=2
D2PPM7	5.30e-12	1	317	358	683	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1
P31434	1.73e-11	1	317	331	635	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001879_00270.