CAZyme Information: MGYG000001880_00413

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; HGM11327; HGM11327
• CAZyme ID: MGYG000001880_00413
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675		77666.58	5.4128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001880	1865592	MAG	Denmark	Europe

• Gene Location: Start: 7754; End: 9781 Strand: -

Full Sequence      

MSTQQKLHLFCGKWITDDEFFKTPARNVFSRQLQRLNLDCSLHRDRHILFRKSFACNEAI
KKAVIYISADDYYKLYINGQFVAQGPAASYYHIYNYNEIDVSEYLKQGENLIAVHTLYQG
LINRVWQSGDNRHGLIFDLEVNGHLAICSDETVKTAVHSAYKEIGTFGCDTGFLEEYDSR
AAEVGFEKTTFDDSSWMQAKLSQTADHTLLPQKTKMLTFEKIFPVKSTAKGNIVFWDFGS
TYAGSLYAKVRGNSGDKIIIHMGQELNGDGGVRYNLRANCIYEESWILSDGICELEQFDY
KAFRYAELILPEECEVQEVFLLARHYPFELKAELKDIYKQNADIANIWQLCVNTQKYGVQ
EAVLDCMEREKGEYLGDGCYTALTHMILTNDDSIARKLIDNAFTTDFIADTLITCLNCSF
IQEIAEFPLMLVKLILWHFRYTGDTEYLRENYTKVINLLEAYRKNYEKDFLISDLDKWCV
VEWPDHFRDGYDVDIGQGQICTETHIAINAYYIEAIKTANKMAKELGYSVYRDDKPLIKA
FVKAFYVPEKHLFKDGIHTEHISMIGNIFPFAFELCPDDACKEQILQIIKNRNIHSVSLF
GAFPLLEGLVRQNKKELILQTICDPGAWLRMLNEGATTTFESWGKDTKSNASLFHMTLSY
AAVFLADINLNLLFK

Enzyme Prediction     

No EC number prediction in MGYG000001880_00413.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	226	664	3.8e-61	0.8591269841269841
CBM67	43	202	1.9e-39	0.8863636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.92e-21	341	663	10	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.79e-16	59	212	2	163	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.47e-07	226	308	1	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10340	ebgA	6.94e-06	49	193	112	254	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	5.27e-05	64	117	86	134	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43798.1	7.16e-209	10	671	75	738
QBE96895.1	6.85e-127	14	655	8	647
BBH20286.1	6.94e-127	14	655	9	657
QMW79864.1	1.05e-125	14	655	8	647
QIB57357.1	1.05e-125	14	655	8	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.90e-17	49	624	178	747	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.14e-15	46	643	130	742	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	2.24e-13	50	224	26	205	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	8.84e-17	145	655	509	1058	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
T2KNB2	2.32e-13	39	649	168	787	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.23e-10	51	643	174	781	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001880_00413.