CAZyme Information: MGYG000001881_00843

Basic Information

• Species: Akkermansia muciniphila_A
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_A
• CAZyme ID: MGYG000001881_00843
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1233		132397.58	4.7116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001881	2552003	MAG	Denmark	Europe

• Gene Location: Start: 5060; End: 8761 Strand: -

Full Sequence      

MVKAFFKSAAYLLTAFFAGGVCVLQAAETAGFGVDLGNGSGTAQEGWTNVTMPATASGGA
NVFVAVPLIRNGAASSSSSVAVGALFGRMVSLTVSAKCSSGGSYTLTEPNTRYTWYEGGK
HRHNGTNADAPSAFEFPKGCEAFNTSMRLSANGMSAASATARLSFSGFQAGKEYAVSFFC
GHNAPAYESITLVSGSLVSVRGLQSSMGNLSGNRFSGLSNSSGQDAYLAVEWKACADEQG
RLVFDVTKEANSSASGRMELNAVTVSTDDSPAPEVPEPRPVSVLHNKALIFLPSSLALPV
PSSTWTAENQLTCEFWVRPNDDAVTGKIISLGNACVSLDHGFLALSAPDGDSVASVKAAG
EELAAGAWHHVAVSVGVEDICLYVDGRLAVSSPRTPYFQAMKSGWKGIVLEAGFKGALDE
LRFWNTALGGEEDDFFMNGPLSLSHPRYGNLVGCWRLDGDFRDAKWTEFSEKTGSAFVRP
YQAVAPEGAEFSIVTDNETFRYMLVTAYVRNVHVIYDWPSRAHLINNSDLIYINSVTPAA
NGSLNFQYPDNDVTESSGVVLLPSDGECSNVLDFSGQGAYMNVGGGLLGAGSSGAFTVEV
RMALDGDGQEAVLFENDNVSMRLEWKEGHYQARIQTGTDKAWVADLPPVEAGRYFWLAFV
RNSSAGTASFYVNGNAVSTAAADAGEMEGTANAVIGRDLDGRIDEMRVWHEARATARLGT
AVQHSWGDRLLMGRWGTSDQFGHDTASWVEHVRILRRLTKGVSGMRIRLGISGGNWSAML
SDANARAAFAENVAEVVRKHQLDGLDLDFEWIEQNNTAAWRNYGELAKAIRTASPDMFFT
ISLHTYYYKFPVAYMQYVDYFTFQNYGPQIDVNGYNSMVSACGTYRSWGYPDSKIMLSAP
FQGTPGAGQGADIRAYRDIVSTCAGVRQDSSLDSASFNYGGGKVKTLHFNGVDTIRKKAR
YISEQQVAGFMYWDLGMDVADSSGKNDYFDECCLLRAANRYVSSTAYPDTPSPFALSSAG
ETIPAGGGAVAVEVQSEEETLGWVVADCPDWISASAVSGIGRTTVMLTAAENKSAAGRSG
TVIFRSSDKQECSVTITQDGAELTGYDKWVQDSFPPDAAADRTAMDAVPAGDGITNLMKY
ATGQDPLKPCGSVTKVTLEEGEDGCMHLVLRWPVNPQATDVKHEVEASTDLADWISLGEV
ETAGKTAAEFRDAEPVRESGMERRFLRLKVTRE

Enzyme Prediction     

No EC number prediction in MGYG000001881_00843.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	765	988	1.8e-31	0.7837837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	1.67e-25	744	978	46	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	4.14e-25	763	978	62	307	Glycosyl hydrolases family 18.
cd00598	GH18_chitinase-like	2.25e-16	722	866	32	176	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd14948	BACON	4.26e-14	1014	1099	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
cd06548	GH18_chitinase	2.96e-11	767	978	85	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHV15109.1	0.0	1	1233	45	1277
QHV17581.1	0.0	1	1233	45	1277
QUF77897.1	0.0	1	1233	1	1233
QEE55402.1	0.0	1	1233	30	1262
QTD80666.1	0.0	1	1233	1	1233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	1.43e-07	763	978	73	290	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.022166	0.965800	0.010672	0.000474	0.000414	0.000435

TMHMM  Annotations     

start	end
5	27