CAZyme Information: MGYG000001881_00973

Basic Information

• Species: Akkermansia muciniphila_A
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_A
• CAZyme ID: MGYG000001881_00973
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	MGYG000001881_7|CGC2	94523.64	9.3975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001881	2552003	MAG	Denmark	Europe

• Gene Location: Start: 78370; End: 80931 Strand: -

Full Sequence      

MFSHAFAVGAVLGTVMSPLVCVSAAERSPVAAAEDVVARVTPSAKGAVLFHLNPDLGNKI
TISGVAGGIRVEAADVRRLVAGYGWYLKNIAKVHFSWNGNRMALPSPLPVPSSPVTIESP
WNIVFAYNYCTLSYTAAFWDWNRWQREIDFLALNGFTHALVTAGLEKTWEDFLIGLGYPR
EKALRFIPNPAFAAWWNMGNLEGHGGPLSQQQIDKMAQMGRRIVSRMEQLGMTPVLQGYV
GFVPSDFQENVQMDGLKLIPQGTWVDNFKRPWVADPTCEAFPKLASDWYKAVRKVYGISG
KMFGGDLFHEGGRKGNINVTNAAQAVQKAMQKASPGASWVIQAWGGNPTRELLSGLDPER
ALVLQLTKDMANGGKNLRTFNGIPWVWCELANFGGNTGLYGGIPLLSRLGSDLSGYRDKG
LVGMGTLSEGLETNPLHYALFSDRLWTGEDISLREWLGKYARQRYGSAPKAVVKALEVLS
SSIYNPVRSQEGCTESIICARPSWNARKASTWSSGERYYHLGDIVKAARGYLKAANDQPN
LVKKETFRYDLVDVVRQVLADAAFYQLQQVRSAFDSGDAAAYKKQVRRFLSLISDMDALL
ATDSQFLLGTWQKRALDWGNSRQEKALMDKSAKMLVTTWSDLAPRSLNDYSNRQWAGLVS
DFYLPRWRNFFESQMDVLTGKKTRDAAHAAFMDKTVREELAFAGNGKIYSAKPAGDTLAV
ANRVMNAHREMLDALSVEEKFSSGIPWELHQGSPLQFDVTDQVTEPGTYTATFQWKNGPS
ALKIHSVKLYEGNKEVAADVHEGTTGVENKNNVYRLELKKYRTNLDSYTLKAEVSGVSQG
ASKGEMMLKRPVN

Enzyme Prediction     

No EC number prediction in MGYG000001881_00973.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	67	726	1.5e-209	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.05e-126	125	447	2	332	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.08e-86	456	722	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	2.58e-13	31	101	1	73	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBH16707.1	0.0	1	853	1	852
QWP64831.1	0.0	1	853	1	852
QHV14058.1	0.0	1	853	1	852
QHV16528.1	0.0	1	853	1	852
QWP38027.1	0.0	1	853	1	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.05e-108	67	680	212	830	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.25e-108	67	680	220	838	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.25e-107	67	680	235	853	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	1.21e-90	64	724	47	707	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	2.18e-91	56	728	91	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	1.10e-89	64	724	70	730	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003100	0.669797	0.325951	0.000625	0.000261	0.000238

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001881_00973.