CAZyme Information: MGYG000001881_01422

Basic Information

• Species: Akkermansia muciniphila_A
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia muciniphila_A
• CAZyme ID: MGYG000001881_01422
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848	MGYG000001881_15|CGC1	97081.8	8.8205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001881	2552003	MAG	Denmark	Europe

• Gene Location: Start: 27896; End: 30442 Strand: -

Full Sequence      

MISYFPKILLLFVLTSLFVFAEDIQKNREREAARSVIMRTVPSLAKAPEKLQLEIIEKED
GHDVFETKASGGILNIRGSSGTALCRGFYDFLKTNRLGMVSWDNKDIRWPAQLPDAAPRR
IVSPFRNHYYFNVVTYGYTMPYWTWERWEKEIDWMALHGIDMPLALVATEGIAIRVWKQL
GLTEKEIEEFYTGPAHLPWQRMGNIVNHDGPLPASWHKEQIALQHRILHRMKSLGMTPIC
PAFSGFVPRGILRLYPEAKLHRLGWGGWPQKNHAHFLSPEDPLFLKIGCLYMQEWQKEFG
KNTYFLADSFNEMELPENKGGAEARNNMLSSLGEQIYRSISSTNPDAVWVMQGWMFGYQR
NIWNADTLKALLSKVPDDKMLLLDLAADYNKTFWRNGMNWDVFKGFFNKPWVYSVVPNMG
GKCAMTGVMDFYANGHLEALNSSSRGRLSGMGMAPEGIENNDVIYELVTDAAWRDRQEDV
EQYLENYCRARYGNYPDSMKEAWNLFRRTAYSNLKDHPRFNWQMKPGTRGCSVNTSEDFL
KGLSLFVNTRGLEQSPLFRQDAVEMTAHYLGIRMNEAILAALEALDEQEMENTKKCMEYF
RKYALRADSLLEGHPTWRLSRWLSFARSHGTSPEEKNKYEQNARRLVTRWGPPVDDYAAK
IWSGLIRDYYLPRWEHFIQSRLSEKNPDMGAWEEKWVRSTGVSAAHAPGDLVNVCRQAIR
EAPPLPSSLKRKAAGSIIGNWTSSTVSTEWSYLDWPVSSADLEKLRGVRFVFTSGSHALE
IDGVELLENGKVIARDRHAGLAGKPSRGNFYKLSLPKGIHANNGCSLRARIRSVGGKSSN
GKLELIKE

Enzyme Prediction     

No EC number prediction in MGYG000001881_01422.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	72	719	9.5e-213	0.9924585218702866

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.64e-174	129	475	2	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	2.14e-50	483	716	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	4.43e-20	31	114	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAA37839.1	0.0	1	848	1	848
QWP24272.1	0.0	1	848	1	848
QWP29344.1	0.0	1	848	1	848
QWP05553.1	0.0	1	848	1	848
QWP47198.1	0.0	1	848	1	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.64e-122	28	680	4	658	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	6.78e-77	49	698	188	841	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	7.62e-77	49	698	196	849	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	6.32e-76	49	698	211	864	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	2.33e-121	28	680	27	681	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	4.20e-115	29	724	45	806	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999165	0.000173	0.000140	0.000140	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001881_01422.