CAZyme Information: MGYG000001884_00001

Basic Information

• Species: UBA1829 sp900760615
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900760615
• CAZyme ID: MGYG000001884_00001
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223		25946.36	6.4981

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001884	3294047	MAG	Denmark	Europe

• Gene Location: Start: 76; End: 747 Strand: +

Full Sequence      

MLSSREGGEFLVEFWKEIAARYKGHPAVWGYDLLNEPHSRYHKPGLPSWNELADRTIRAI
REIDAVTPVIVEPDHMASPHMLEYLPVFSVPNVIYSIHTYTPGSITHQLNPRAEKFVGYP
DGQWDKQGAIREWLEPVREFQRKTGARIYVGEFGCVRWAPGAADYIRDCIEFFEECGWDW
TYHAFREWHGWSAEHSDDPSVMTPVPTTKRKEVLLKAFEKNKK

Enzyme Prediction     

No EC number prediction in MGYG000001884_00001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	11	197	1.3e-32	0.52

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	7.38e-19	9	183	104	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	7.48e-08	9	198	163	377	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44326.1	3.07e-109	1	223	296	519
AVM44708.1	7.23e-70	1	222	278	499
AVM46198.1	2.81e-66	1	222	273	501
AVM44768.1	3.41e-65	1	223	286	512
AVM43433.1	4.95e-62	1	223	285	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LX4_A	4.30e-12	3	175	111	275	CrystalStructure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_B Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_C Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],4LX4_D Crystal Structure Determination of Pseudomonas stutzeri endoglucanase Cel5A using a Twinned Data Set [Pseudomonas stutzeri A1501],6R2J_A Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_B Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_C Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501],6R2J_D Crystal Structure of Pseudomonas stutzeri endoglucanase Cel5A in complex with cellobiose [Pseudomonas stutzeri A1501]
6JYZ_A	1.69e-06	11	201	197	372	ChainA, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
4EE9_A	3.38e-06	16	154	115	247	Crystalstructure of the RBcel1 endo-1,4-glucanase [uncultured bacterium],4M24_A Crystal structure of the endo-1,4-glucanase, RBcel1, in complex with cellobiose [uncultured bacterium]
7P6G_A	8.23e-06	16	154	115	247	ChainA, Endoglucanase [uncultured bacterium],7P6G_B Chain B, Endoglucanase [uncultured bacterium],7P6H_A Chain A, Endoglucanase [uncultured bacterium],7P6H_B Chain B, Endoglucanase [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25472	7.12e-10	13	154	136	266	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001884_00001.