CAZyme Information: MGYG000001884_00516

Basic Information

• Species: UBA1829 sp900760615
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900760615
• CAZyme ID: MGYG000001884_00516
• CAZy Family: CE1
• CAZyme Description: S-formylglutathione hydrolase FrmB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259		29156.91	6.0777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001884	3294047	MAG	Denmark	Europe

• Gene Location: Start: 2650; End: 3429 Strand: -

Full Sequence      

MAFIQCNFHSDCLGMAASVNVILPQKSRTQIGMEGSSSAPEGAPVLYLLHGLSDDHTIWM
RRTSIERYAAAYGLAVVMPCVNRSFYNNTPDGMRFWDYVSEELPALLPSFFHVSTKREDT
FVAGLSMGGFGAFKLALNHPDRYAAAASLSGSLRNDWLAENNRAFYDWLFGKPEQFQGSQ
NDLRTLAERVVASGGPRPELFQACGTEDFLYNVNTEFRDHLRAIGYEHTWLEGPGTHCWE
YWDARIQDVLKWLPLKGKA

Enzyme Prediction     

No EC number prediction in MGYG000001884_00516.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	11	253	3.1e-51	0.973568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.43e-47	12	254	21	309	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.99e-23	23	253	4	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	6.76e-15	38	254	93	296	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	4.34e-14	44	150	48	175	S-formylglutathione hydrolase
PRK10439	PRK10439	2.61e-09	95	253	265	406	enterobactin/ferric enterobactin esterase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG70609.1	4.66e-17	42	249	65	309
SNW20539.1	7.62e-17	38	249	71	324
BCJ79116.1	1.21e-16	42	249	65	309
BCI83238.1	1.21e-16	42	249	65	309
QVI28069.1	1.90e-16	38	249	67	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	2.52e-103	1	256	2	264	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	2.30e-52	1	253	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	1.09e-51	2	253	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
4ROT_A	1.57e-51	1	255	8	259	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	5.97e-47	2	258	6	257	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.28e-35	1	253	1	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P31951	3.27e-16	42	257	70	327	Diacylglycerol acyltransferase/mycolyltransferase Ag85B OS=Mycobacterium leprae (strain TN) OX=272631 GN=fbpB PE=3 SV=2
Q06947	1.97e-14	38	249	68	314	Diacylglycerol acyltransferase/mycolyltransferase Ag85B OS=Mycobacterium avium OX=1764 GN=fbpB PE=3 SV=1
Q49575	1.73e-13	38	249	68	314	Diacylglycerol acyltransferase/mycolyltransferase Ag85B OS=Mycobacterium intracellulare (strain ATCC 13950 / DSM 43223 / JCM 6384 / NCTC 13025 / 3600) OX=487521 GN=fbpB PE=3 SV=2
B1XEU8	7.15e-13	9	230	20	256	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001884_00516.