CAZyme Information: MGYG000001884_00527

Basic Information

• Species: UBA1829 sp900760615
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900760615
• CAZyme ID: MGYG000001884_00527
• CAZy Family: GH10
• CAZyme Description: Anti-sigma-I factor RsgI6

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442	MGYG000001884_42|CGC1	51594.65	6.7729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001884	3294047	MAG	Denmark	Europe

• Gene Location: Start: 3243; End: 4571 Strand: -

Full Sequence      

MELTAQDKIKTLMRFFDHPKAGTWERVELDIKRNRMGWGTLFLKDPGGNPLKNREIKIRQ
LNHDFRFGCNIFKLKDFAEPEKNTAYEEYFKRVFNEAVVPLLWDSTEPEQGKLRYAANSP
AMKRRPSADMVIDWCEQNNIAPKGHWLFCDNFVPRWLPSDSRKVMYLLEKRIAGLAERYG
ERIRKWDVVNESFTYHPRRSALIGDAAVPPDYVWQTFKMAEKYLPFQDELIYNDGTDISF
RAFAHDSSPMFLLADRLLRRGVKLNGIGLQFHMYADNVMQHAEPNVKNFFDPAHLLQVLD
QLGQLGLPLHISEISLTTYPDLPRNLAEELQAQVLRNFYRIWFSHRNCGSIVYWNLCDQT
AYGNENKHNACLIGADFQEKPSYKMLDQLVNKEWHTETAVVTDSNGEASWNGFYGDYELD
IAGEKRIVSMNPRSENEYKINL

Enzyme Prediction     

No EC number prediction in MGYG000001884_00527.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	62	385	4e-49	0.9570957095709571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	4.61e-42	103	386	3	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	5.55e-37	83	384	24	306	Glycosyl hydrolase family 10.
COG3693	XynA	4.62e-32	87	386	51	337	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW04637.1	4.35e-105	26	428	34	428
QHV94149.1	2.13e-102	26	431	34	430
AHF90707.1	2.63e-102	4	442	7	455
QIP12711.1	1.20e-101	31	442	39	445
AXE20297.1	3.09e-101	25	440	33	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D88_A	2.31e-29	23	428	43	404	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]
7D89_A	7.17e-28	23	428	43	404	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]
3NIY_A	4.07e-19	54	393	18	339	Crystalstructure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NIY_B Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NJ3_A Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1],3NJ3_B Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1]
3WUB_A	1.78e-18	83	391	27	313	Thewild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUF_A	8.10e-18	103	391	49	313	Themutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4XVN1	3.38e-17	83	391	65	351	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
Q2PGV8	1.08e-15	103	383	79	348	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1
P23360	8.68e-15	103	388	77	325	Endo-1,4-beta-xylanase OS=Thermoascus aurantiacus OX=5087 GN=XYNA PE=1 SV=4
Q4P902	1.42e-13	103	391	86	340	Endo-1,4-beta-xylanase UM03411 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=UMAG_03411 PE=1 SV=1
Q84WT5	1.88e-13	51	422	201	539	Endo-1,4-beta-xylanase 5-like OS=Arabidopsis thaliana OX=3702 GN=At4g33820 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001884_00527.