CAZyme Information: MGYG000001884_01072

Basic Information

• Species: UBA1829 sp900760615
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900760615
• CAZyme ID: MGYG000001884_01072
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
220		26129.8	5.3881

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001884	3294047	MAG	Denmark	Europe

• Gene Location: Start: 5240; End: 5902 Strand: -

Full Sequence      

MAVQPFPYRYYDELDRIMTAYRDFQYNGCFLHAIATGELISPFGEAEECPELKGAVDYWA
VNLYTRELVDSRKKDLSASRFPHKKLRMIDKDFYLEEMYPEGMTAMLERFRDKPVYITEN
GCSCNDDRFRIVYLTLYLSAVHDALKRGMDVRSYLYWSLMDNYEWSSFLPRFGLVNVDFN
TFERTPKPSAAFYREIIEHNGFSQEILRKYLHELPVLQTV

Enzyme Prediction     

No EC number prediction in MGYG000001884_01072.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	201	9.6e-45	0.47086247086247085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	2.48e-35	15	206	237	459	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	6.68e-34	16	202	234	453	Glycosyl hydrolase family 1.
PRK13511	PRK13511	8.64e-22	99	198	350	464	6-phospho-beta-galactosidase; Provisional
PLN02814	PLN02814	4.38e-17	42	193	305	476	beta-glucosidase
PLN02998	PLN02998	1.19e-14	15	198	274	486	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43515.1	1.50e-151	1	218	201	418
ADW18818.1	1.71e-94	6	218	221	433
ADQ08048.1	5.31e-66	11	215	220	424
QCX34294.1	7.48e-58	11	215	218	422
QNM13665.1	2.63e-55	4	218	212	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z1H_A	1.83e-31	25	205	250	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
1VFF_A	6.13e-30	13	218	219	422	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]
1GOW_A	1.84e-26	30	220	289	487	Beta-GlycosidaseFrom Sulfolobus Solfataricus [Saccharolobus solfataricus],1GOW_B Beta-Glycosidase From Sulfolobus Solfataricus [Saccharolobus solfataricus]
4EAM_A	1.84e-26	30	220	289	487	1.70Aresolution structure of apo beta-glycosidase (W33G) from sulfolobus solfataricus [Saccharolobus solfataricus P2],4EAM_B 1.70A resolution structure of apo beta-glycosidase (W33G) from sulfolobus solfataricus [Saccharolobus solfataricus P2],4EAN_A 1.75A resolution structure of indole bound beta-glycosidase (W33G) from sulfolobus solfataricus [Saccharolobus solfataricus P2],4EAN_B 1.75A resolution structure of indole bound beta-glycosidase (W33G) from sulfolobus solfataricus [Saccharolobus solfataricus P2],5IXE_A 1.75A RESOLUTION STRUCTURE OF 5-Fluoroindole BOUND BETA-GLYCOSIDASE (W33G) FROM SULFOLOBUS SOLFATARICUS [Saccharolobus solfataricus P2],5IXE_B 1.75A RESOLUTION STRUCTURE OF 5-Fluoroindole BOUND BETA-GLYCOSIDASE (W33G) FROM SULFOLOBUS SOLFATARICUS [Saccharolobus solfataricus P2]
1UWQ_A	1.84e-26	30	220	289	487	Structureof beta-glycosidase from Sulfolobus solfataricus [Saccharolobus solfataricus],1UWQ_B Structure of beta-glycosidase from Sulfolobus solfataricus [Saccharolobus solfataricus],1UWR_A Structure of beta-glycosidase from Sulfolobus solfataricus in complex with 2-deoxy-2-fluoro-galactose [Saccharolobus solfataricus],1UWR_B Structure of beta-glycosidase from Sulfolobus solfataricus in complex with 2-deoxy-2-fluoro-galactose [Saccharolobus solfataricus],1UWS_A Structure of beta-glycosidase from Sulfolobus solfataricus in complex with 2-deoxy-2-fluoro-glucose [Saccharolobus solfataricus],1UWS_B Structure of beta-glycosidase from Sulfolobus solfataricus in complex with 2-deoxy-2-fluoro-glucose [Saccharolobus solfataricus],1UWT_A Structure of beta-glycosidase from Sulfolobus solfataricus in complex with D-galactohydroximo-1,5-lactam [Saccharolobus solfataricus],1UWT_B Structure of beta-glycosidase from Sulfolobus solfataricus in complex with D-galactohydroximo-1,5-lactam [Saccharolobus solfataricus],1UWU_A Structure of beta-glycosidase from Sulfolobus solfataricus in complex with D-glucohydroximo-1,5-lactam [Saccharolobus solfataricus],1UWU_B Structure of beta-glycosidase from Sulfolobus solfataricus in complex with D-glucohydroximo-1,5-lactam [Saccharolobus solfataricus],2CEQ_A Beta-glycosidase from Sulfolobus solfataricus in complex with glucoimidazole [Saccharolobus solfataricus],2CEQ_B Beta-glycosidase from Sulfolobus solfataricus in complex with glucoimidazole [Saccharolobus solfataricus],2CER_A Beta-glycosidase from Sulfolobus solfataricus in complex with phenethyl-substituted glucoimidazole [Saccharolobus solfataricus],2CER_B Beta-glycosidase from Sulfolobus solfataricus in complex with phenethyl-substituted glucoimidazole [Saccharolobus solfataricus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22498	1.01e-25	30	220	289	487	Beta-galactosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=lacS PE=1 SV=2
P14288	1.02e-25	30	220	292	489	Beta-galactosidase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=bgaS PE=1 SV=2
P50388	2.61e-25	30	220	289	487	Beta-galactosidase OS=Saccharolobus shibatae OX=2286 GN=bglY PE=3 SV=1
P10482	1.86e-20	57	201	298	455	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P26208	4.61e-20	56	202	288	448	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001884_01072.