CAZyme Information: MGYG000001884_01343

Basic Information

• Species: UBA1829 sp900760615
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900760615
• CAZyme ID: MGYG000001884_01343
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		72214.53	9.7313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001884	3294047	MAG	Denmark	Europe

• Gene Location: Start: 280; End: 2217 Strand: +

Full Sequence      

MKIPVTAMILFLAVCTATALETAAILDKLRQEQLTIPLRSAQLLRQYAAVQNPDGSWNDI
DYRDRNHSRWQTAAHIQRTLHLVQAWAKTGQPLFHDEAVGRAVRRAVAFWSRHRFQCGNW
WWNEIGVPERMGNIMITAPELFRDPEERKNALAVVRQAAFGKTGQNRIWKAETVLKRALL
EQDGPTARQAVAEITSELQICDGEGIQEDGSFHQHGRQLQLGNYGLSFLRSMSRWNSILA
GTPLAFPPERTAALRHLVLNGYRWVIWNGRFDLLAQGRQIGRNSQTQKAKAALRAAAALR
KADPGSGELYRDILRQKPPFTGNRHFFNSDYMVHRRPSWYASVRMNSTRTVPVEDRINWE
NALGRYFSDGVMLVMRSGDEYRDITACWDWTRLPGTTLPATPVLTEQECRKLKIREASGK
TPRWTLSRHWRKTGESDFTGGVSDGTRGAAAYTQDLDGVRAKKAYFFDHDAIYALGCGIH
STSPCSVATTVENSLRNGEIKHGDGWFWHNGIGYRGTGIEDFSGSRNGDWRYVDGGIKTP
APDRKELFVLQIRHGIGCRDASYSYVILPDVSAQETAGWNGGKVLANTPDVQAVEFVDGT
RAAVFHKPGSLGDFSASKAGLYLIGPDKVLYSDPSGDGKTVSLNR

Enzyme Prediction     

No EC number prediction in MGYG000001884_01343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	324	571	5e-52	0.9919678714859438

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	6.80e-111	23	624	3	679	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.08e-61	323	572	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	3.44e-37	40	287	29	291	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	5.55e-07	585	642	1	67	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45527.1	2.48e-220	21	645	188	825
AQT67414.1	2.67e-108	54	611	69	631
QIK53168.1	6.06e-102	53	643	87	695
QIK58581.1	1.27e-100	54	643	88	695
QEK52064.1	2.30e-98	26	632	66	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	6.80e-72	22	611	5	608	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	7.42e-72	13	611	18	630	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1RWA_A	1.61e-31	78	632	78	690	Crystalstructure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
1RW9_A	1.61e-31	78	632	78	690	Crystalstructure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
6F2P_A	6.75e-23	52	595	53	650	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	4.06e-71	13	611	18	630	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q54873	2.09e-15	59	492	338	814	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999108	0.000142	0.000166	0.000135	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001884_01343.