CAZyme Information: MGYG000001884_01631

Basic Information

• Species: UBA1829 sp900760615
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900760615
• CAZyme ID: MGYG000001884_01631
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688		78416.3	9.4699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001884	3294047	MAG	Denmark	Europe

• Gene Location: Start: 1995; End: 4061 Strand: -

Full Sequence      

MIPAGPEPGFTPSGGFLFGVCGHTQNRKDPEEIVLEAETAALCGVKAIRQDLRWRMLERK
KGKWDFSGFDRIVNEFSSRGVEIMPILYGIPAWERNEKDLPTDTGWRNYLTRVFQRWRGN
FRFWEIWNEPDLLSFGKFSAPEYLELLRSARDVQRKTAPDALLFNGGFTTMLPHASLKPG
FQEYILTRGSGLFDIHAFHGHGSFKGYVEQIRLLAEQRKRLSVGIPWFANETAVSSYGIG
ELRQAETLYKKLLFSWANGAMGYHWYELRNSGFSGNNPEHNYGLVTKDFYPRAAYPVYNM
LSRNFRRHRFVRRIPATRNFFLYEFASGTSRIIAAWNDAPEKEPNGVAVFRTNAADAAEI
DLMDNASPVKVRNGIVLYPVSASPSALKLKQGTAEYLGPLFRITVPEEKTAGNRVGLEFE
LFNPMETPEEFYFTFENAANLRFRLNAGEKCRRSVHLKFPETEKHLRKIFCRVSFAGFSF
RTSIPLKQSVTIPAKRGPEDCDFILNRKDQVRSLFDADPANVDKVWSGPQDLSAKIRFAR
TEETLELFADVTDDKHVQPESGQFLWKGDSIQVAFQVLGQKTLWVLGGALSNSGTPELYL
WETPEGFDPREICRKMKLNVERRGQQTRYRLTIPLNAVGLLPAMLRKGIRISLIVNDNDG
YGRKGWAAVSEGVSSNRNAELYPLLQFE

Enzyme Prediction     

No EC number prediction in MGYG000001884_01631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	60	337	3.6e-17	0.7262180974477959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.71e-57	502	687	2	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	2.22e-10	522	680	26	186	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	1.05e-06	517	666	3	155	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG3693	XynA	0.003	52	164	67	190	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
smart00633	Glyco_10	0.007	52	164	1	126	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46276.1	1.60e-149	1	688	430	1137
AVM47149.1	1.55e-146	1	688	594	1307
AVM44759.1	6.98e-139	6	688	258	965
AHF94342.1	6.07e-129	1	688	316	1033
AHF90198.1	1.85e-113	1	687	303	1005

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	1.25e-13	19	400	107	509	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001884_01631.