CAZyme Information: MGYG000001884_01651

Basic Information

• Species: UBA1829 sp900760615
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900760615
• CAZyme ID: MGYG000001884_01651
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		66810.88	9.654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001884	3294047	MAG	Denmark	Europe

• Gene Location: Start: 1414; End: 3177 Strand: -

Full Sequence      

MKTTLITCAAVLAALSLNGGSLMPVKGKISIAGADGTSFRSKDGTLILKREKPSFQQFMR
GIIRFKPHLDGKFAHDDALVIELKTEKDFTLRLRWRKSDRMMCHLDDVPVKAGKEFQEIV
VPMPVTGGKALESLDMQLTPDPGTVEIRKIAIEKPKKVTLAITSPVTKVQNELVFKGTTA
DPDAEVKICIRNSRGEVKSKTVKSRQGKFELRWKRPPVNIGLWNTAYAEIGDGSVSANVS
IPLRIFGYRANDNYAWLKVKGKDIVTSKESKDGEQTFIPVGIGYCRDVIIPAQDEEVMKY
CKERGLNTIRLPFYTRFFNNRDTDPLDIDEHIRDFILPVVLAAKRHNLYVILDDHGYFTA
KIDEAKARQKQSARWNEAGFNEWIRRWVKVAEFFRNEPNVLGYELLNEPHDIPHETTRKW
YTNCLKAIRKADQRHIVLLGNADWSHSRTIEKTWGPVASTVDAPYNNVVFSFHDYPEDNH
PWIVAGHITRFREKHNVPVMCTEFGATHWNKSETVCRSFISGVITLFARENTGWMIWALK
YLKDNPRAPYNPVDKVGMNPPSYDSCSYSDIWIPAAKIMASPFPKAK

Enzyme Prediction     

No EC number prediction in MGYG000001884_01651.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	279	545	6.3e-43	0.7381818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.56e-27	294	541	26	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.50e-11	295	572	76	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDT89144.1	5.38e-158	227	584	4	363
QEC61327.1	2.37e-23	300	544	102	336
AIA99611.1	3.47e-23	295	545	103	346
AIA99600.1	1.13e-22	295	545	102	345
QIK53840.1	3.66e-22	295	540	101	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KDD_A	3.91e-12	294	479	43	209	endoglucanase[Fervidobacterium pennivorans DSM 9078]
3AMC_A	4.96e-12	295	537	36	286	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3NCO_A	1.64e-11	294	506	43	263	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]
3RJX_A	1.64e-11	294	506	43	263	CrystalStructure of Hyperthermophilic Endo-Beta-1,4-glucanase [Fervidobacterium nodosum Rt17-B1]
3RJY_A	1.64e-11	294	506	43	263	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	9.04e-13	300	477	78	258	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
P22541	1.65e-10	305	505	161	336	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P23548	4.21e-08	295	482	80	284	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
P23044	1.59e-06	349	538	114	317	Endoglucanase 1 OS=Robillarda sp. (strain Y-20) OX=72589 GN=eg 1 PE=1 SV=2
Q6L6S1	8.22e-06	357	444	182	280	Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.039471	0.769522	0.190085	0.000316	0.000286	0.000288

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001884_01651.