CAZyme Information: MGYG000001884_01993

Basic Information

• Species: UBA1829 sp900760615
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900760615
• CAZyme ID: MGYG000001884_01993
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		38998.18	5.8792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001884	3294047	MAG	Denmark	Europe

• Gene Location: Start: 2041; End: 3048 Strand: +

Full Sequence      

MNRDFIFKGVTFGYYARNGYFSSDAAKREADKIAALKIPWVCIVATIMQEQFSSTRQFRD
FTITPGDDELCDIIDYLHELGIKVMLRPMIECWDGTQRYLLQLPNGVIFEDRPFRYRDLW
FENYCAVTRHYTRIATRCRCEAYGLDSELNNLVPFTDHWMKVVETARAGFKGHLTTSLIN
AQQFLPLLKDHPDHWFYALDSVGTSMYSPASKNGGDSVGKMMLQLSDVVRACRDFAEVYR
KPFYFGECGCCAMENASTRPAYWNNGRKYDGEEQAKYLDAVIRAFSAEPWWHGLFWWKWD
EQNYRPQFHDDPAGDKGFTIDGKPAADIMKQWCEE

Enzyme Prediction     

No EC number prediction in MGYG000001884_01993.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	7	330	4.2e-71	0.9934640522875817

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19608	GH113_mannanase-like	5.52e-70	5	332	1	309	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
cd19606	GH113-like	1.37e-37	8	330	3	300	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EIP97756.1	6.72e-123	10	332	1	324
EIP99431.1	9.76e-100	9	335	203	541
AHF90006.1	1.33e-98	9	335	56	394
EIP99672.1	4.04e-98	9	335	17	349
AHF90739.1	3.66e-83	8	332	24	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CD6_A	1.03e-36	8	329	14	310	Thestructure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG [Alicyclobacillus acidocaldarius],4CD7_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD7_B The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManIFG and beta-1,4-mannobiose [Alicyclobacillus acidocaldarius],4CD8_A The structure of GH113 beta-mannanase AaManA from Alicyclobacillus acidocaldarius in complex with ManMIm [Alicyclobacillus acidocaldarius]
3CIV_A	1.68e-36	8	329	37	333	Crystalstructure of the endo-beta-1,4-mannanase from Alicyclobacillus acidocaldarius [Alicyclobacillus acidocaldarius]
5YLH_A	8.73e-35	8	332	5	305	Structureof GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLH_B Structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112]
5YLI_A	6.45e-34	8	332	5	305	Complexstructure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLI_B Complex structure of GH113 beta-1,4-mannanase [Amphibacillus xylanus NBRC 15112],5YLK_A Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLK_B Complex structure of GH 113 family beta-1,4-mannanase with mannobiose [Amphibacillus xylanus NBRC 15112],5YLL_A Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5YLL_B Structure of GH113 beta-1,4-mannanase complex with M6. [Amphibacillus xylanus NBRC 15112],5Z4T_A Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112],5Z4T_B Complex structure - AxMan113A-M3 [Amphibacillus xylanus NBRC 15112]
7DV7_A	7.01e-28	8	332	39	339	ChainA, Endo-beta-1,4-mannanase [Bacillus sp. N16-5],7DV7_B Chain B, Endo-beta-1,4-mannanase [Bacillus sp. N16-5]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001884_01993.