CAZyme Information: MGYG000001884_02855

Basic Information

• Species: UBA1829 sp900760615
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900760615
• CAZyme ID: MGYG000001884_02855
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		40163.61	9.9907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001884	3294047	MAG	Denmark	Europe

• Gene Location: Start: 66; End: 1151 Strand: -

Full Sequence      

MKKRFLIVKPSSLGDVIHAFPAVSLLARHEPEAEIDWMVVPAFAPIVRYHPAVDGVILFR
RKELGQLPKFPKAFSELLSGIRKARYDGVIDLQGLLRSAVISRLAKTRVVAGPAVSREWG
TGIFYQRRLDPGDRFRHAVRKNLSMMAEFLGVPEPDEAEFEFRGNPAAAQRVVTLLRGFA
KEKLIAVAPGARWHSKQWPPEFFAETLNLFYRDHHDYSFVILGAPDEKPLGEQLQKHLKA
PAVNLIGLTGIPELVEAIRRSRLLFCNDSGPMHIAAALGTPLVCMFGPTDPVLTGPFSDR
RWNASNVSAGSANTGSVTGQFPPEMQKNPRKNCLGSETALVIRRIPMYDMQEPNNCKELA
L

Enzyme Prediction     

No EC number prediction in MGYG000001884_02855.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	77	305	1.9e-54	0.8844444444444445

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.38e-63	4	300	1	236	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.98e-61	3	309	2	301	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02193	heptsyl_trn_I	5.96e-53	4	313	1	305	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam01075	Glyco_transf_9	4.81e-44	81	300	8	223	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	5.85e-34	4	301	1	292	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43682.1	1.72e-64	3	297	82	375
QSH41947.1	4.42e-58	3	299	10	310
CBK42726.1	8.08e-55	3	297	6	292
QOV90040.1	7.71e-54	3	297	11	295
BBM87885.1	1.88e-53	3	301	4	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	1.13e-28	4	301	2	294	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	1.13e-28	4	301	2	294	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.30e-28	4	301	2	294	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
3TOV_A	2.74e-17	3	297	9	298	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	7.71e-12	4	300	2	301	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24173	5.44e-28	4	301	2	294	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P26469	6.55e-25	4	313	2	306	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
Q57336	7.46e-21	3	299	9	294	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P45042	1.67e-19	6	300	4	301	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
Q9R9D5	3.96e-19	14	299	5	289	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001884_02855.