CAZyme Information: MGYG000001885_00393

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000001885_00393
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722	MGYG000001885_11|CGC1	80990.89	5.295

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001885	2138069	MAG	Denmark	Europe

• Gene Location: Start: 6437; End: 8605 Strand: -

Full Sequence      

MKKVLYFLLFFSVFFNLSALEPGKTYSISHGSKAVFVRDAGLKTGAKAIMWTDTKVPAQR
WVLEQRSDDDAYLLRNLYSGYYLGVTGTKAGATADQRLYSRILSRWTLEASESGWMLVAA
RSPEYCLAVESNEEGAGLTLVEKATADPAKCVFTINESAETPEAYNADVRDAIMDGFIKQ
YYNVAAKGHVLGGGGWWGDAEMFETILDAFATTGDPKYKDIFRELYVNFIDRNRSDWSYN
EYNDDITWMVLACARAYQYFGDSEYLNNARDNYKRMYDRAHQRFGTLIWKQSQENKLSTN
SCINCPATIAACYLGRLTGDESWFTKAISIYAGQRKLLYNPSNGEVADCRAWKSDGTMEN
DYNHWVSTYNQGTMLGAALALYDHTKDPMYMQDAKKIYERSRDGLTNSDKIISVCQTING
DLCGFKGILMRYVREYAEVNHLEEPLLWMEKNAWHAYQNRNSKGVVWSAWLTKTNENLKR
MEGDSEKNVTNDAFGSSTAVSVAFNAHVNRQFSKSALEGLEAKYFDGIQFAQLDDELADG
DTPNTKASSYSNAHICFRNVDFGTTGLDKAIVRVNTTGRRTFVKVYADSIADETMLGRNE
GFLDREWADVEIPMSKSLTGIHDVYVQFVGIGVQFHNMRFADSGAGVESAEADSRSTMRL
SGRELVVECAEESVLEVYSASGALELRRSLSEGTSTVELKPGVHICRLAQAPEVAPFKAI
VK

Enzyme Prediction     

No EC number prediction in MGYG000001885_00393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	170	491	7.6e-55	0.9050279329608939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.30e-36	165	432	1	287	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	1.59e-12	196	438	46	279	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
cd04084	CBM6_xylanase-like	2.49e-06	551	630	31	110	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
pfam14200	RicinB_lectin_2	1.14e-05	15	96	5	88	Ricin-type beta-trefoil lectin domain-like.
cd04792	LanM-like	1.40e-05	158	422	507	758	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74831.1	1.98e-115	1	644	1	653
QEC70572.1	4.38e-83	19	505	27	494
QIA07414.1	4.92e-79	18	643	62	674
AYD48939.1	5.35e-66	23	506	31	495
QOV19890.1	3.66e-56	165	640	24	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BOK_A	8.93e-35	197	470	39	317	ChainA, Alpha-1,6-mannanase [Niallia circulans]
4BOJ_A	9.51e-35	197	470	42	320	ChainA, Alpha-1,6-mannanase [Niallia circulans],4BOJ_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4BOJ_C Chain C, Alpha-1,6-mannanase [Niallia circulans]
4D4A_A	4.69e-34	197	470	60	338	ChainA, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]
5M77_A	5.78e-34	197	628	73	506	ChainA, Alpha-1,6-mannanase [Niallia circulans],5M77_B Chain B, Alpha-1,6-mannanase [Niallia circulans]
5AGD_A	2.17e-33	197	470	60	338	ChainA, Alpha-1,6-mannanase [Niallia circulans],5AGD_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBM_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBW_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBW_B Chain B, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000299	0.999021	0.000236	0.000146	0.000146	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001885_00393.