CAZyme Information: MGYG000001885_00634

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000001885_00634
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628		70862.88	5.1301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001885	2138069	MAG	Denmark	Europe

• Gene Location: Start: 21920; End: 23806 Strand: -

Full Sequence      

MLEKLPAGAIEPEGWLLRQCELQRDGLNGHLGEISAWLDKNNNAWLVEGGDRGWEEVPYW
LRGYSHLAYLLHDEKMLEETKFWIDAVLGSQKEDGYFGPVNLRNGKREVWAQMIMLWCLQ
NWYEYTADERVLPFMKKYFEWEMAQEDADFLEDYWENCRGGDNMWSVVWYYGKTGDASVL
PLIEKLHRNNADCTNPAALPNWHNVNIAQYFREPAEMYLLTGDSTLLQASYNVHDLVRRS
FGQVPGGMFGADENARIGYIDPRQGTETCGFAEQMLSDGVMIGITADPLWAENMEDVAFN
SFPAAMMPDLRSLRYITSPNHTVSDSKNHHPGIDNRGPFLNMNPFSSRCCQHNHGLGWPS
FVQSLAYSTPDGGVAYAVYGPNKATLDVAGGKRVTITEDTRYPFSDTLRFTIAAKEKAKY
PIYFRIPSWTTGATAMVNGKLTGAPVAGEYLRIERTWKDGDRVELVFPMRLTVRRWPTNQ
NSASVNYGPLTLSLRIAEQYRKVNSAEAAIGDSRWQEGADPEKWPTWEIYAGSPWNYALI
LPDDNDVSRLTVRHKPWPADNQPFTREGAPIEVTALGRLIPSWGIDGTGLTGVLPPASAP
RSDYVSPITLIPMGAARLRISSFPTSNK

Enzyme Prediction     

No EC number prediction in MGYG000001885_00634.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	215	490	5.1e-30	0.5248091603053435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.74e-110	42	493	50	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.60e-28	53	504	57	512	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APS23119.1	2.63e-169	4	626	58	667
AWL89945.1	1.05e-168	4	626	58	667
ALU92252.1	2.95e-168	4	626	58	667
QXQ95199.1	5.71e-168	4	626	58	667
BAG23430.1	9.02e-167	4	625	58	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	7.68e-15	267	494	381	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	3.82e-14	203	494	265	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.30e-11	203	494	265	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999320	0.000696	0.000011	0.000003	0.000001	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001885_00634.