CAZyme Information: MGYG000001886_00371

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella
• CAZyme ID: MGYG000001886_00371
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1029		115685.79	6.2207

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001886	3040279	MAG	Denmark	Europe

• Gene Location: Start: 4270; End: 7359 Strand: -

Full Sequence      

MKRILNILGTLCLWLGCLWGAAPAAARSFVHPGVLHTKERMEQIRSLVEAGRGEAYESYL
LLKAHPCAQADYKMEGPFEVISRDGEFRHTKSRMERDFSAAYLNALMWSITGEEAHARKA
EEVLAAYARTLKRIPDTNDAPLLAGLEGFKIVYALEVLKHTYPKLSDENYEAALRMFTKI
FLPVLDTFYKREPYTNGNWGAIATKTYMAAAIHLDDEKMYEKARAFYLDGKDNGTLEHYI
DGATGQIQESGRDQSHCMLGLGAMATVCELAWQQGDDLYSAKDNRLLKGYEYVARYNLGY
DVPFTKWTDITGKYCDWDKVSEKARGRYMFVFDIAYNHYVNRMGLPMPFTSQVLEQLRPE
GYDRDQPGFGTLLFNETPQNRKFQHPGGLHTLADLERMKTMVAQGQRPWMEGWEELQKDP
LAQSTYRPRPMANMGQSRQSASVDAHAAYLNAIRWYVSGDTAYAHCAIRILNAWSAAVNQ
VPKAKSDQGLVGIPIGEFAMAAEVLRACPLWEKSDLARFQKMMVEYLYPVSHDFLSTHGG
SNVDYCWTNWDACNMVALAAIGVLCDRGDIYREAIEYFKHGLGNGSIRNAVPHLHRMEDG
TVIGQWQESGRDQGHAQLGVGFLATLCQIAWNQGDDLFAYDNNRLLAGAEYVARHNQMRG
VPFAYYDNSQGLNNRWPSINGLGRLEDRPVWEMIYNHYEVLKGIPARYSKRMAELLRPEH
GSKDHFGYGTLTFTLCPSNYPPLPVPAVPVGLSTEVSVGQVRLEWEPSAEYFANGYVIQR
SEAGKNEFKDVAVYEEKVTNYFVDTDVEEGKAYEYRVAAVNKTGTSRFSESIGAVMVPLQ
ELPAGWTYGEVGTVEGGRAAYAATQGGSVWLESRSGAMGPATANAPFVYRAVKGDFSVSC
RVNAIQGRVDECGLMLRGSLQADAPVVTMTLGHWGRRFARMGWRPAADEERHFAIGNTYT
WLPAWFKLARVGDVFYAYESTDGVNWYYVHSQKVDMPEEILVGMTGSFTGGEGQNGIVFD
HLEVYDNRF

Enzyme Prediction     

No EC number prediction in MGYG000001886_00371.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	7.46e-21	444	655	57	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam05426	Alginate_lyase	2.72e-18	66	296	18	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
cd00063	FN3	3.12e-11	754	832	10	89	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
pfam07081	DUF1349	2.39e-08	884	1024	28	166	Protein of unknown function (DUF1349). This family consists of several hypothetical bacterial proteins but contains one sequence from Saccharomyces cerevisiae. Members of this family are typically around 200 residues in length. The function of this family is unknown.
smart00060	FN3	9.44e-08	754	826	10	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP82777.1	3.67e-208	372	1024	27	676
QUT56879.1	9.01e-158	4	383	8	384
QQY39805.1	3.46e-157	4	383	8	384
ABR37862.1	3.46e-157	4	383	8	384
AXP82778.1	1.32e-147	372	1024	20	675

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16950	6.41e-06	733	840	1154	1261	Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus OX=1516 GN=apu PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002677	0.827646	0.168491	0.000577	0.000305	0.000273

TMHMM  Annotations     

start	end
7	26