CAZyme Information: MGYG000001886_01060

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella
• CAZyme ID: MGYG000001886_01060
• CAZy Family: PL26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737		83404.25	6.1014

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001886	3040279	MAG	Denmark	Europe

• Gene Location: Start: 81; End: 2294 Strand: +

Full Sequence      

MQAGIPKQGNRLMDSLCLEGRKVGGAARLLCTTQDRPSAEGGEALRFAGYEGRVERAVVE
RVGDVRAVVRLEGRYAGQDGRLWLPFTVRLYFYAGSEEVRMVHSFVFDGDMDRDFIRSLG
VQFEVPMREAAYNRHVAFAAADGGVWAEPVQPLVGRRVLTLDGQTDWQVRQMRGERIPEY
ERFDAKNRNLIDHWAVWNGFRLSQSTPDAFTVRKRTHAGRPWIGTFSGTRAPGYAFVGDV
TGGLGVGLKDFWQSCPTALQVDSAAAATALLTVWLWSPEPMDLRHYDYVAHDLEASYEDV
QEGMSTPCGVARTHTLTLLPAAAYAGKAEVARMAALLAEDAPLLCTPEYLHAKRAFGIWS
LPDRTNEKRAKVEDRLDDYLDYYVEAVDEHRWYGFWNYGDFMHTYDPVRHTWRYDVGGYA
WDNTELASNMWLWYSFLRTGRADLWRMAVAMSRHTGECDVYHLGPYAGLGSRHNVSHWGC
GAKEARISQAAWNRFYHYLAADERSGDLMTEVKDADQKLYEIDPMRLALPRSQYPCTAPA
RLRVGPDWLAYAGNWMTEWERTGNKAYRDKIIAGMKSIAALPNGIFTGPGVLGFDPATGV
LSYEGDPELQHTEHLTTIMGGFQVMNELMEMIDLPEWNRTWLTFAQEYKEKALAIKHNRF
PVTRLKAYAAAKTGRKDLADEAWKELWSVWHNDKPFTVNRIEAPEVPSPVAENPVVCTND
AATWSLAAIYMQEVIPE

Enzyme Prediction     

EC	4.2.2.24

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	2	735	5.6e-293	0.8723897911832946

CDD Domains     

MGYG000001886_01060 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTZ55478.1	0.0	3	737	337	1075
QUT56846.1	0.0	1	736	358	1101
QQY43085.1	0.0	1	736	351	1094
QJR77978.1	0.0	1	736	351	1094
AII64733.1	0.0	1	736	351	1094

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	3.64e-160	5	729	129	891	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_B	1.57e-158	5	729	129	891	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_A	1.66e-158	5	729	129	891	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	6.18e-158	5	729	129	891	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31530	4.41e-165	5	735	110	842	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001886_01060.