CAZyme Information: MGYG000001887_00674

Basic Information

• Species: Ruminiclostridium_E sp003512525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E; Ruminiclostridium_E sp003512525
• CAZyme ID: MGYG000001887_00674
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		52583.82	4.2482

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001887	2739679	MAG	Denmark	Europe

• Gene Location: Start: 59016; End: 60440 Strand: -

Full Sequence      

MKARALKAIIAAVLAVSMLAGCAGNTSSGGSSPISSDTVSSDVTTSGTTSSEAGSSDTVS
SSEISADESTSQDVSAEDSSESSTDSSAQSSEQSTTQSGEEESSNDTSGPAGESEPGVMR
DITSQQLVDDMTFGWNLGNTLDVCQADRDGDGKVNEHVEEGEKVDETLWGNPKATYELFA
QLKSDGINAVRIPVTWRDHMDADGNIDKEWMDRVQQVVDYAYSQEMYVIINVHHDGGGDP
KFGAWIIEESQKDYDAFLKKYKNVWEQIAERFKNYSDYLIFESMNEVGFDNLYNKNKADA
YDLINKINRDFVDIIRATGGNNAKRHLLIAGYYTDIERTCDSLFKMPEDPENRCIVSVHY
YTPWDFCTCDIKHTWGTKNEVRQMETLIGKMKTNFVDKGIPVIIGEYAASGSDLSSCIFF
IEKLNKLCSDYGIATFIWDNGGQINRTTYQWRTPQYLEVLKRATSGEDYEVVKN

Enzyme Prediction     

No EC number prediction in MGYG000001887_00674.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	166	441	9.9e-101	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.27e-54	166	442	16	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	7.53e-26	124	409	44	323	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL35063.1	8.86e-248	117	473	138	494
CBK96026.1	3.98e-247	111	473	83	449
CCO05659.1	9.17e-164	109	471	37	394
CBL17363.1	3.90e-94	117	467	29	377
BCN30798.1	1.18e-87	118	462	79	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQP_A	4.34e-66	116	462	8	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6XRK_A	8.18e-65	123	466	23	373	GH5-4broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate],6XRK_B GH5-4 broad specificity endoglucanase from an uncultured bovine rumen ciliate [uncultured bovine rumen ciliate]
6XSU_A	9.82e-65	121	453	10	340	GH5-4broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens],6XSU_B GH5-4 broad specificity endoglucanase from Ruminococcus flavefaciens [Ruminococcus flavefaciens]
4X0V_A	4.37e-63	126	462	42	393	Structureof a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_B Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_C Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_D Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_E Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_F Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_G Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_H Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32]
5D9N_A	1.05e-62	123	463	12	350	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9N_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9P_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii],5D9P_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P28621	4.61e-58	111	466	30	376	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
O08342	2.56e-57	119	441	35	369	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P23660	2.96e-56	117	460	20	359	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
Q12647	5.43e-56	119	460	20	359	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P28623	3.56e-55	119	466	38	374	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000052	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001887_00674.