CAZyme Information: MGYG000001888_00714

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UMGS775
• CAZyme ID: MGYG000001888_00714
• CAZy Family: GT108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		35592.38	4.9564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001888	1136142	MAG	Denmark	Europe

• Gene Location: Start: 780; End: 1724 Strand: +

Full Sequence      

MEPIKERREKFESDKKIYKSEVLKFAGVNGRDVYNCSIPFDHEGDRYIFGRVERRTEWAN
SVTYLFRYDRESGVWNKVENFDALPIEDPFVSVIGGELIVGGTHVVFVSGKIADYSTYFY
KGKSPFSLRLFSTGPSDMKDIRLFEIPDGRIGVFSRPRNEEIRKKYGSGSIVGVTVIDSI
EQLTPERIENAEYIHGMFGEDEWGGMNQAFYLKGELVGAIGHQCYNDYRDGVEYPVYINM
MYIVDFEKRKVLEKRVIGTTDCYPDTPSKLPTLCDCAFTSGVVPAEKGKVSLYSGLRDCC
EGCIVIDDPFAAVG

Enzyme Prediction     

No EC number prediction in MGYG000001888_00714.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT108	13	310	1.4e-95	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08950	DUF1861	2.95e-115	9	311	1	295	Protein of unknown function (DUF1861). This hypothetical protein, found in bacteria and in the eukaryote Leishmania, has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CQR55755.1	1.02e-106	4	314	3	313
QQZ64301.1	1.02e-106	4	314	3	313
AIQ43225.1	1.45e-106	6	314	5	313
QNK57878.1	2.92e-106	4	314	3	313
AIQ28189.1	2.36e-105	4	314	3	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q4X_A	2.57e-83	8	314	35	333	Structureof MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana [Leishmania mexicana MHOM/GT/2001/U1103],6Q4X_B Structure of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana [Leishmania mexicana MHOM/GT/2001/U1103],6Q4Y_A Structure of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana, in complex with mannose [Leishmania mexicana MHOM/GT/2001/U1103],6Q4Y_B Structure of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana, in complex with mannose [Leishmania mexicana MHOM/GT/2001/U1103]
6Q4Z_A	1.46e-82	8	314	35	333	Structureof an inactive variant (D94N) of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana, in complex with beta-1,2-mannobiose [Leishmania mexicana MHOM/GT/2001/U1103],6Q4Z_B Structure of an inactive variant (D94N) of MPT-2, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana, in complex with beta-1,2-mannobiose [Leishmania mexicana MHOM/GT/2001/U1103]
6Q50_A	5.64e-78	4	314	21	321	Structureof MPT-4, a mannose phosphorylase from Leishmania mexicana, in complex with phosphate ion [Leishmania mexicana MHOM/GT/2001/U1103]
2B4W_A	3.15e-75	11	314	8	301	Hypotheticalprotein from leishmania major [Leishmania major]
6Q4W_A	1.67e-65	7	314	41	340	Structureof MPT-1, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana [Leishmania mexicana MHOM/GT/2001/U1103],6Q4W_B Structure of MPT-1, a GDP-Man-dependent mannosyltransferase from Leishmania mexicana [Leishmania mexicana MHOM/GT/2001/U1103]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001888_00714.