CAZyme Information: MGYG000001889_01545

Basic Information

• Species: QALW01 sp900547955
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; QALW01; QALW01 sp900547955
• CAZyme ID: MGYG000001889_01545
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850		96612.22	5.3347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001889	1964997	MAG	Denmark	Europe

• Gene Location: Start: 1097; End: 3649 Strand: +

Full Sequence      

MLRVNKLYVDYSEYDVIDNDHPAFSWSAVSELSNSEQTGYEIEVSNKKTGKVLWTGGALK
KEQRAKYEGPAFEAGEVYCARVRLTDNHGRISNWSAPKEFTAGKMEWQAGWIAVKEDKVR
VPAQFYTSFENKGDIAGCVIFVCGVGYHRVSVNGQPLKRGELAPSYTNFAKLCCYEVLDA
GRLLKEGVNDVAVTVADGWRRMDSQFIFDHIRREIEFFGAPQLSASIKLSMTDGSVKWIH
TDNSNWRARRTPIIEANLYDGMVYDERLKGREEELTVINAPALGVMRADTAEPITMHEVY
KPVSIFWPRPGVAVVDFGQNIAGFCRLRLPEKMLEGQSVVIEHAEMLDEDGTLYMAPLRG
VKARDEFISSGREYNNEYFSPAFTYHGFRYAQISGYEDFSVEDIEAVALYSDMASGSFFE
CGSPMLNRIHKNCVQTEKSNIYSIFTDCPQRNERMAWINDLTPRFGALPYNFNVSRLFTK
TVRDIINDQQDGMIAYTNPYIYSARPADPVCSSFLIAGLQSLLFAGNHELIREGYEHFKA
WEDYLLGRSEDYILNFTLNGDWASPDYACIDAERCYSAVTPGELLSTGYSYYNCLLLSLF
AQHLGLTEQSEKYAQTAQRIREAFLNKWFDAQTGRVGTGSDACQAFALWLDILPEESRAR
AAEFMRDQLRNNHYRFTAGSICLRYMVEMLTRYGYADDAYTLMTLDKYPSYGYSIQNEGT
TIWERFELKKNPTMNSHSHPMYASVDKWLYGYICGVSVLEPGCANIRIQPYFPTGLLSAQ
CRINTIKGDIGVRWVRKYGAFHIYLNIPFGVKAQLYLPAVYSEEAPKIEYGQPQEIGSGC
YCFTIGTEEK

Enzyme Prediction     

No EC number prediction in MGYG000001889_01545.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	308	817	4.2e-133	0.9920634920634921

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.09e-80	417	753	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	2.06e-30	309	410	4	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.68e-28	133	298	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	9.17e-11	755	818	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	8.41e-159	2	847	32	888
QEC51112.1	2.34e-143	2	819	69	897
VEH16339.1	1.64e-141	1	818	31	854
AEF82974.1	3.85e-136	19	818	28	842
ABW01021.1	7.72e-131	17	847	21	892

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.64e-129	17	843	46	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	6.90e-82	17	845	18	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	3.49e-79	140	847	321	1023	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	3.20e-81	22	850	51	915	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	1.65e-78	140	847	321	1023	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.29e-76	22	823	55	884	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
T2KPL4	6.41e-70	17	817	46	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001889_01545.