CAZyme Information: MGYG000001890_00639

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinatimonas
• CAZyme ID: MGYG000001890_00639
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		47619.09	9.9507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001890	2091221	MAG	Denmark	Europe

• Gene Location: Start: 27302; End: 28606 Strand: +

Full Sequence      

MPNQVSVSTNTPHLYALIAGESSGDTLGAGLMRAILRLDPKASFIGIGGEQMQKAGLTSL
GKMEVLSVMGIFEVAAHLVPIMRLRAALIKQLLKARPSVVIGIDSPDFNLGLERHMKKAG
IPTVHYVSPSVWAWREGRMKKIKESCDEVLALLPFEKEFYDRENMPCTYVGHTLANKIPL
QVSQETAKTQIELETTSVDPVQGKVMAILAGSRKNELVHMVPVYAQTARLIKKKMPDVVF
ISACPDKARAEVLKDLWLSHAPDLSLTIYVGCTHAAIAASDAVLLTSGTVAFEAMLLKRP
MAVAYKVNPLTAIIGRRLLKINMFSLPNLLAKRRIVAEFIQEQCTPEALAQEMLKLLTSD
NLLMKNEFLSMHKAMIKNSDEIAAKAVLSLIKKSGRNAVETKDNKAFNGMVEPSFTVPSN
IAGADRAKRQEPRL

Enzyme Prediction     

No EC number prediction in MGYG000001890_00639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	16	373	1.8e-123	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.81e-168	16	396	5	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	9.10e-136	16	393	5	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.96e-111	16	387	2	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.95e-109	16	390	9	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	1.52e-45	13	350	227	563	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWL03673.1	1.08e-110	7	393	1	381
QBY05541.1	1.30e-110	7	391	1	379
BCV37365.1	1.53e-110	7	393	1	381
QIJ05384.1	3.06e-110	7	393	1	381
QGS59279.1	4.33e-110	7	393	1	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.00e-91	12	390	6	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.42e-91	12	390	6	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KZ10	1.74e-107	7	391	1	379	Lipid-A-disaccharide synthase OS=Shewanella sp. (strain ANA-3) OX=94122 GN=lpxB PE=3 SV=1
Q8EGG2	6.96e-107	7	391	1	379	Lipid-A-disaccharide synthase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=lpxB PE=3 SV=1
Q0HT75	9.84e-107	7	391	1	379	Lipid-A-disaccharide synthase OS=Shewanella sp. (strain MR-7) OX=60481 GN=lpxB PE=3 SV=1
Q0HGW8	9.84e-107	7	391	1	379	Lipid-A-disaccharide synthase OS=Shewanella sp. (strain MR-4) OX=60480 GN=lpxB PE=3 SV=1
Q87MF0	1.62e-106	12	393	4	379	Lipid-A-disaccharide synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001890_00639.