CAZyme Information: MGYG000001892_00571

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000001892_00571
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42127.11	7.8333

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001892	1491266	MAG	Denmark	Europe

• Gene Location: Start: 1016; End: 2158 Strand: -

Full Sequence      

MAKDIVWLAGETSGDFIASLVLPHVAALYPDERMLGIGGDRMIAAGLDAWHHSSVLSVRG
YVEVLKKLPSLLRLRSEMKKRTAELHPRAFIGVDAPDFNLAIEEHLRGRGIKTIHLVCPS
IWAWRPERIHQIKRAVDHMLLIFPFEKKLMDEAGIDSTYIGHPLAREIPMQPDKEAARTK
LGIAGHEGPVFAVLPGSRQAEVAWCGPHFFGACEKVLDFDRRSIFLVPASDAAREAQIQS
VLKNFPKAQAATRIISTGSHTVMEASDAILVASGTATLEAALFKRPMVVGYAMPGITGIL
MQKKGIIDFVSLPNILAGERLVPEILQYYCRAETLAFALWHEYERRNDTVLMDRFVKMHE
SLLRDTPKLAADAIARVCGD

Enzyme Prediction     

No EC number prediction in MGYG000001892_00571.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	361	7.4e-111	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.89e-146	9	379	8	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.36e-120	9	374	8	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.26e-99	5	374	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.16e-88	5	360	8	360	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	1.56e-47	9	326	233	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU65980.1	1.58e-156	2	377	6	380
QQQ97139.1	1.58e-156	2	377	6	380
QDA54177.1	4.90e-138	3	376	13	387
QQS88891.1	1.26e-135	3	374	12	384
BBF22932.1	7.72e-135	6	374	16	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.46e-77	5	374	9	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.91e-77	5	374	9	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2JIB3	8.50e-111	5	377	10	381	Lipid-A-disaccharide synthase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=lpxB PE=3 SV=1
Q39F56	7.80e-109	5	377	10	381	Lipid-A-disaccharide synthase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=lpxB PE=3 SV=1
A4JF62	1.10e-108	5	377	10	381	Lipid-A-disaccharide synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=lpxB PE=3 SV=1
Q3JR42	1.51e-108	5	377	10	381	Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=lpxB PE=3 SV=1
A3NAT4	1.51e-108	5	377	10	381	Lipid-A-disaccharide synthase OS=Burkholderia pseudomallei (strain 668) OX=320373 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001892_00571.