CAZyme Information: MGYG000001892_00639

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000001892_00639
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		26227.08	8.0729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001892	1491266	MAG	Denmark	Europe

• Gene Location: Start: 14039; End: 14734 Strand: +

Full Sequence      

MKIKSTVKTICLAVLALFVIVEGYYVGQVLWYSISPVETSAYIESERERLGRVSYKPVLL
KNVSSDMVRATVAAEDARFMEHIGIEWEATGEAFVSNVIEGERAPGGSTITQQTVKNLFL
SHEKSYIRKAQEMFLALVMDATWSKGRILQTYLNIAEFGEGIFGVEAAARHYYGVSARRL
THWQSVWLAAILSNPRYYEKHGSTDWLRHRIDVIEGSMKEPQFASINNRMH

Enzyme Prediction     

No EC number prediction in MGYG000001892_00639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	54	218	3.9e-56	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	9.53e-80	12	218	10	223	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	2.02e-66	49	219	7	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02070	mono_pep_trsgly	2.56e-60	8	218	1	218	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.45e-59	57	220	78	242	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.61e-38	57	198	69	210	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ97963.1	2.45e-70	7	219	14	231
ANU66032.1	2.53e-70	7	219	15	232
AZV92425.1	1.02e-54	10	220	24	239
QBR39352.1	1.02e-54	10	220	24	239
AJD49758.1	2.65e-53	10	218	17	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	2.78e-25	58	225	23	190	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.08e-24	58	225	23	190	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5FGZ_A	6.84e-23	67	198	168	303	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	6.90e-23	67	198	189	324	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3DWK_A	4.02e-22	55	198	27	170	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2KUU2	3.83e-52	10	219	16	235	Biosynthetic peptidoglycan transglycosylase OS=Bordetella avium (strain 197N) OX=360910 GN=mtgA PE=3 SV=1
Q7W3V2	3.67e-50	7	219	15	237	Biosynthetic peptidoglycan transglycosylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=mtgA PE=3 SV=1
Q7WF82	3.67e-50	7	219	15	237	Biosynthetic peptidoglycan transglycosylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=mtgA PE=3 SV=1
Q7W039	3.67e-50	7	219	15	237	Biosynthetic peptidoglycan transglycosylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=mtgA PE=3 SV=2
Q3SFZ8	4.95e-48	13	222	14	232	Biosynthetic peptidoglycan transglycosylase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.980020	0.017829	0.000654	0.000066	0.000044	0.001417

TMHMM  Annotations     

start	end
12	34