CAZyme Information: MGYG000001893_00127

Basic Information

• Species: CAG-145 sp900542565
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; CAG-145; CAG-145 sp900542565
• CAZyme ID: MGYG000001893_00127
• CAZy Family: GT26
• CAZyme Description: N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	MGYG000001893_1|CGC1	29309.88	8.9076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001893	2137652	MAG	Denmark	Europe

• Gene Location: Start: 140939; End: 141724 Strand: -

Full Sequence      

MDGALEKVKDSDGYLETVSLFDFQVCDTTYDYFLHYIERSIAAGQRKIILAFNPKKVALA
HESEITGKALKSADILIPDGYGIILASKLLGNRIQNRITGTDLMSLLCHTLAKESDERQY
GIYIYGATPESLRDAVDKLRKENVHIVGGMDGYDHEDDEVVRAINRSGATILFVALGSPK
QEIFIYNNADKLHNVRLIMGVGGSVDVISGHAKRAPVIIRKIGLEWLFRMICKPTRIREN
KTIITYAKIVLDERRRIRKTG

Enzyme Prediction     

No EC number prediction in MGYG000001893_00127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	70	238	2.9e-53	0.9766081871345029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1922	WecG	1.97e-69	15	259	7	251	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
pfam03808	Glyco_tran_WecB	1.58e-67	73	238	1	166	Glycosyl transferase WecB/TagA/CpsF family.
cd06533	Glyco_transf_WecG_TagA	2.01e-67	70	236	1	166	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
TIGR00696	wecG_tagA_cpsF	2.35e-47	70	246	3	177	bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK03692	PRK03692	4.48e-40	33	238	23	226	putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMX82277.1	4.09e-57	30	261	16	244
ATA61492.1	4.09e-57	30	261	16	244
QIZ65930.1	4.09e-57	30	261	16	244
ASS87139.1	4.09e-57	30	261	16	244
QHN50501.1	1.16e-56	30	261	16	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MPK_A	9.29e-38	15	258	1	244	ChainA, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_A Chain A, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9]
5WB4_A	4.85e-26	48	210	34	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_B Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_C Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_D Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_E Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_F Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_G Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9],5WB4_H Crystal structure of the TarA wall teichoic acid glycosyltransferase [Thermoanaerobacter italicus Ab9]
5WFG_A	9.53e-26	48	210	34	195	Crystalstructure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_B Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_C Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_D Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_E Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9],5WFG_F Crystal structure of the TarA wall teichoic acid glycosyltransferase bound to UDP [Thermoanaerobacter italicus Ab9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7MYM6	5.70e-36	35	246	24	236	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=wecG PE=3 SV=1
P27620	1.49e-35	35	253	26	237	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagA PE=1 SV=1
Q8RKI7	1.17e-34	15	255	1	239	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarA PE=3 SV=1
A9MJ15	3.78e-33	35	248	25	239	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=wecG PE=3 SV=1
B5YY43	5.31e-33	35	248	25	239	UDP-N-acetyl-D-mannosaminuronic acid transferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) OX=444450 GN=wecG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001893_00127.