CAZyme Information: MGYG000001894_01567

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000001894_01567
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		44256.72	9.907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001894	1739362	MAG	Denmark	Europe

• Gene Location: Start: 555; End: 1742 Strand: -

Full Sequence      

MKIYLIAGEPSGDLLGSRFMRAMRKKIGAEAEFFGVGGDTMEAEGLKSLFDISDLAVMGL
TEVIPSIPRVLRRIRETVADIVRVQPDVVVTIDSWSFSSRVHKALRKLKTGIPQAHYVAP
QVWAWKKKRARTMYKYVDVLMTLFPYEPKYFTPYKLDTRFVGHPVIESEVITTNGDDFRR
KYNIAQDKKIITVLPGSRKNEVAKLLPVFLEAAKELKAVDENLFFVIPTVRTVAENVKKQ
VQQSGLPILVVETQADRYGAFRASSAAIAASGTVALELAICDIPHIIAYKVSPFSAMLAR
KFLHIEFVNLSNILLGREIIPELLQERCVPGNIRSYVTELLRHGDLYEKQMGGFAKVREI
LGQGVQTPSQNACDVILELAARKNKETSCQNKKMG

Enzyme Prediction     

No EC number prediction in MGYG000001894_01567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	361	6e-119	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	1.08e-135	1	380	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	2.76e-134	1	385	2	380	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	2.72e-98	3	365	1	363	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.91e-77	3	379	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.89e-48	1	379	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10250.1	1.61e-182	1	383	5	387
ARJ65449.1	2.46e-109	3	386	8	391
CUW40282.1	9.89e-109	3	388	8	393
BAE51288.1	4.79e-108	1	386	1	386
ACI98608.1	1.55e-106	3	383	6	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.61e-57	1	380	7	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.25e-57	1	380	7	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W4D7	9.57e-109	1	386	1	386	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
B6IST7	3.10e-107	3	383	6	386	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1
Q5FUA3	2.97e-85	3	379	31	404	Lipid-A-disaccharide synthase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=lpxB PE=3 SV=1
Q3SRI5	4.67e-79	2	378	12	387	Lipid-A-disaccharide synthase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=lpxB PE=3 SV=1
Q89KQ7	1.17e-78	2	377	10	384	Lipid-A-disaccharide synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001894_01567.