CAZyme Information: MGYG000001894_01616

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000001894_01616
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247		28305.83	10.4748

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001894	1739362	MAG	Denmark	Europe

• Gene Location: Start: 1911; End: 2654 Strand: +

Full Sequence      

MRFSVSKNLMFFLVLLMLVQPVQAKAYNEIIDDSMVCINATQKMEKVYQIKKHMLTTISS
VEAGRWNAEKKQKNAWPWTVNAQGKGRYFSTKAEAVREVKKLQAQGVKSIDVGCMQINLA
YHPDAFKSVEDAFDPQKNAEYAAKFLKKLYKNNDRDWIKAAMAYHSSVPTKALRYKKKIV
SAYELVKQAQNNLDKSLFGEQNKVKAAKAETSASKYAKKDTKAAKRAYADANQWREAKLA
EWRMKNK

Enzyme Prediction     

No EC number prediction in MGYG000001894_01616.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	54	190	7.8e-16	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	7.41e-11	109	184	30	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16892	LT_VirB1-like	1.52e-09	80	151	31	101	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	1.24e-06	108	166	32	94	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	5.75e-06	112	165	25	79	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	0.002	114	178	186	250	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10590.1	5.37e-60	17	191	1	175
AMW35440.1	1.45e-46	32	175	40	182
CAX83981.1	1.04e-44	36	190	32	185
QEX18932.1	2.66e-44	32	183	60	210
QXM24158.1	3.40e-44	37	183	43	188

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000193	0.999219	0.000151	0.000147	0.000136	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001894_01616.