CAZyme Information: MGYG000001895_00586

Basic Information

• Species: Zag111 sp900555325
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp900555325
• CAZyme ID: MGYG000001895_00586
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		34358.18	4.878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001895	1985063	MAG	Denmark	Europe

• Gene Location: Start: 79566; End: 80447 Strand: +

Full Sequence      

MYEPEVTIITTTSNIVDKGQTDDFTLLINLLDRQTYPYVEHLIIDNASQDGTVELLKEYK
NNGFINFFSEPDHGKFDAYNKGIMRAKGKYIAFLSCDDFYHDITGISDVITLMEEENADF
CFFPSYCCHPDGYVFLFTPAMLNAFQVTPCPRQAMFFKREALEQLRYFDDKFKLLADYDL
TIRLMLNGFKGVFFDGNIVTYKLGEQVAKHTVQVEAECSHIFYKNYKNMYPMTNEVLDRM
VKFSEVPRPLLEKFADKFPPEDRNLFFERYEAMYNLRLQAVQNMKAQERNNRG

Enzyme Prediction     

No EC number prediction in MGYG000001895_00586.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	30	124	5.2e-16	0.5588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06433	GT_2_WfgS_like	1.36e-44	34	204	23	196	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	2.03e-19	27	194	15	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
PRK10063	PRK10063	1.03e-15	40	204	35	198	colanic acid biosynthesis glycosyltransferase WcaE.
pfam00535	Glycos_transf_2	6.08e-14	33	119	22	109	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04186	GT_2_like_c	7.88e-13	15	190	3	153	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR37746.1	3.56e-127	3	285	2	284
BBM41656.1	7.04e-34	4	285	193	478
QTO25874.1	5.62e-24	4	241	9	240
QCQ34168.1	1.18e-22	4	230	13	233
BAU11416.1	1.90e-21	34	185	26	182

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71239	3.91e-12	40	221	35	215	Putative colanic acid biosynthesis glycosyl transferase WcaE OS=Escherichia coli (strain K12) OX=83333 GN=wcaE PE=4 SV=2
P11290	2.09e-07	22	122	19	126	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
Q4UM29	5.29e-07	34	120	318	403	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q92IF9	7.07e-07	34	120	318	403	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q1RIM7	9.87e-07	34	120	316	401	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001895_00586.