CAZyme Information: MGYG000001896_00981

Basic Information

• Species: UMGS1840 sp900555525
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1840; UMGS1840; UMGS1840; UMGS1840 sp900555525
• CAZyme ID: MGYG000001896_00981
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472		53832.97	6.3523

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001896	2208881	MAG	Denmark	Europe

• Gene Location: Start: 4400; End: 5818 Strand: +

Full Sequence      

MKVLYAAAEAAPFIKVGGLGDVMGGLPKELCKEGIDARVVIPMYSQINEEMRKKAEFVTS
ISVPLGWRMSYCGIFKAEIDGVTYYLIDNEQYFKRAGVYGEFDDAERFSFFSKAVLEILP
HIGFFPDIINANDWHTALVPLYLNAFYRNINEYRNIKTVLSIHNIEFQGQYDPLILGHVL
GLDVTYRSIFMYDGCLNILKAGIESANIVTTVSKNYAQEILDPYFSCGLHNILEPRKYKL
RGIVNGIDTETFNPKTDPNIYHNYDYSSIRFKTNNKKEFQKDMALEVDSKKPLIGMVTRL
TSQKGMDLIGEVMRELVKLDMQFVVLGTGYPEYEGMMRYWENECHDKVRGIIKFSSELAS
KIYAASDLFLMPSKSEPCGLAQMIAMRYGTVPIVHAVGGLGETVHPYNPETKEGNGITFQ
SYNAWDMFDAIKRGLALYNDKENWKVLRKNAMHTDFSWAVSAKEYIEIYKNL

Enzyme Prediction     

No EC number prediction in MGYG000001896_00981.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	470	1.5e-179	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	1	470	1	476	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	1	472	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	1	472	1	463	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	471	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14098	PRK14098	1.17e-113	2	472	7	486	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS09312.1	2.86e-185	1	472	1	471
SQH55555.1	4.06e-185	1	472	1	471
QGS08181.1	7.65e-183	1	472	1	471
QIX87763.1	2.18e-182	1	472	1	471
AME09419.1	2.51e-181	1	470	1	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	2.06e-91	1	469	10	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	1.90e-85	2	470	126	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	2.40e-84	1	472	1	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	4.19e-84	1	472	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	3.26e-83	1	472	1	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q18A79	1.00e-158	1	472	1	478	Glycogen synthase OS=Clostridioides difficile (strain 630) OX=272563 GN=glgA PE=3 SV=1
B2V049	2.67e-158	1	472	1	475	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	1.08e-157	1	472	1	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
A6M334	5.14e-156	1	472	1	475	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1
B7HBC4	6.58e-156	1	472	1	474	Glycogen synthase OS=Bacillus cereus (strain B4264) OX=405532 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001896_00981.