CAZyme Information: MGYG000001896_01065

Basic Information

• Species: UMGS1840 sp900555525
• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1840; UMGS1840; UMGS1840; UMGS1840 sp900555525
• CAZyme ID: MGYG000001896_01065
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1286	MGYG000001896_63|CGC1	147990.93	5.0419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001896	2208881	MAG	Denmark	Europe

• Gene Location: Start: 5741; End: 9601 Strand: -

Full Sequence      

MLQSEQKISLNGYWDFMPFYDRESVFELPASLKYEEEKVIVPSTWRGFSSDSDKIDKYDF
YPMNVFDYPKEWSRAMCGILHRSFTYKKHDNERVFIKFDAVGQETHVILNGEKIAVWDEG
YLPLEIEITDKVKDENELYVLCSTWKKVKIPSGAEKSTALVGSWFGYLMRGIWQDCMLIT
RPSVYISDCEIVPSVRREKIDINISVDGSTEELEAIAEIKDKDGKTVKTVTACGKGEITL
SDSWKDAIFWDCENPYLYTAEIQLKKDGGVLYTKAVRFGFREFWAEGQNFILNGVHVNLR
GDSWHFQGAGQQTKEYALNWCRLCKEHGANSIRFHAEPHPEYYLDAADETGILIVDETAI
YGSGKSMDAAHPEYIENCRKHIKRFVKRDKNHPSVVIWSLQNEMRWVDGRDEYKKHVPEL
MEIFHKNDPQKRLVSLDGDNRLIDKEHTEVASLHYNIDGTINQWDRLHPLTIGEHGGLWY
ICPQNSSMYLGLKTYQDSDYCADGISVKEQIFMEYARFQKVSGISSFNFAHYFALPMPDH
DIPYENNGDVTDFGVHPKLIKKYSLTINNGRLKDYPYYMPNSTCKYATEGMRPVTIILSE
YNHSFYDDEDITKTLNVFNDTLSDRDVKVDVNVTYNGENIFSTDFSFRGKAGEFYSKKIT
FAPPMVSKRESIHFSAAIYHDKQHIYTYEKDFSVYPHSLKTEPVTQNKAYWYGNDCDMKK
VGALVPNLIKIESFSELGTDTKLLIVGSNIKTPSKSEDDALRKYFNDGGSVLLFEQFSYA
PGEMTVIKKDFLRAQASDYSHPILKGLSDDDLTYWNEAVFEEGPDPFIHSAFEKPVSGDY
KVILESSYGDFNDGGDLWSPLLEYRHKNASVIGCQLDVMKMFNKTPQAAVLARNMIEYIT
KEMQAKNNRTAAAVTDKHKKFLDTLGVSYEEYENGKDYDLIIASADCADKLKGEKGRIFV
LPEDAKDGEKLSCTLGINAKTWERPTYELKADYNFDEMKTVSIVDMFGYDKPGMSPRETK
NRPIAFDAVKCEGAQTLMESIEGNIWYDLFINGWTAELQKRALVEFNKINAQASEAYYVK
KDNVYICRFAAEPEYDKSVRMYTNLLSNLGCEFKENKIEYVKAEAKNAIEMIMSLPYLSY
QDYDRALEYYSDPEFSLNNLGEGLYGWMKKWERDPVDGFMKTNNTKNKTLFVTTFVHNLN
RPFETESPAEREYKLDLISNSPYKLYINGEQISGDTVTLKSGINRFFMLVNVGDEDFTFR
AVFKNPDGTCADNLLYRVTTDEVDPK

Enzyme Prediction     

No EC number prediction in MGYG000001896_01065.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	644	1.5e-82	0.6742021276595744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.11e-45	4	412	9	425	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.54e-38	3	403	8	417	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.39e-31	10	455	44	490	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	2.55e-23	4	411	49	480	beta-galactosidase.
pfam02836	Glyco_hydro_2_C	7.66e-15	283	520	8	236	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ71089.1	0.0	8	1286	5	1343
AYB44654.1	0.0	10	1286	7	1403
CQR58310.1	0.0	8	1286	5	1343
QOT12559.1	0.0	10	1286	7	1406
AIQ32428.1	0.0	8	1286	5	1408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.36e-29	5	455	36	484	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.37e-29	5	455	37	485	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
7KGY_A	7.23e-29	4	432	14	446	ChainA, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_B Chain B, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_C Chain C, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_D Chain D, Beta-glucuronidase [Faecalibacterium prausnitzii]
3DEC_A	7.51e-28	3	403	40	460	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
6D1N_A	1.20e-27	2	403	31	421	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4S2K9	1.63e-33	6	403	46	460	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1
O52847	2.96e-31	9	469	60	539	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q56307	7.47e-29	5	455	37	485	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q48727	6.04e-28	6	403	36	431	Beta-galactosidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=lacZ PE=3 SV=3
T2KPJ7	1.34e-27	1	432	47	465	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001896_01065.