CAZyme Information: MGYG000001898_00736

Basic Information

• Species: Parabacteroides sp900552415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552415
• CAZyme ID: MGYG000001898_00736
• CAZy Family: GT23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000001898_16|CGC2	36720.78	8.6731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001898	3107743	MAG	Denmark	Europe

• Gene Location: Start: 30535; End: 31473 Strand: +

Full Sequence      

MLSIEEYTKVNESYSKVLTYKVGIDSGFFSEYNNMILAMLYCLENQIQFRLCSGGTNFNP
TKGWNGYFNNFCDTVEDRQSHYRTLDWKYALKLIVKRRDRSAIRSLYPYLSFWKRNLLTQ
DVFGKCRDKSRYKKLHIIPDLDFRGSTQELCFLLVNLTWKYNATTQRRIDEIVNALSLPS
KYVSIHVRRGDKIVESSYYPLNQYFEKLDGNIKDLFVATDDYSVVEDIKSKYTDWNVWTL
CSSSERGYSQSSADKENAIEKDRNMITLFATMEILNKSERFVGTYSSNIGMFQGMRKPSI
CQGVDFDRWLVW

Enzyme Prediction     

No EC number prediction in MGYG000001898_00736.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT23	14	290	1.3e-24	0.8459119496855346

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11300	Fut8_like	1.63e-12	160	290	164	301	Alpha 1-6-fucosyltransferase. Alpha 1,6-fucosyltransferase (Fut8) transfers a fucose moiety from GDP-fucose to the reducing terminal N-acetylglucosamine of the core structure of Asn-linked oligosaccharides, in a process termed core fucosylation. Core fucosylation is essential for the function of growth factor receptors. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	1.47e-06	160	288	50	192	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCY57900.1	1.77e-172	2	312	1	311
QUT51863.1	1.77e-172	2	312	1	311
QED36504.1	5.83e-70	4	312	7	311
SDS80372.1	6.57e-69	5	312	8	311
BCI62108.1	1.27e-68	4	312	2	310

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001898_00736.