CAZyme Information: MGYG000001898_01002

Basic Information

• Species: Parabacteroides sp900552415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552415
• CAZyme ID: MGYG000001898_01002
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
828		94174.52	6.0787

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001898	3107743	MAG	Denmark	Europe

• Gene Location: Start: 3830; End: 6316 Strand: -

Full Sequence      

MQNARKILATAALISSCAFAYGQDRIPSILPEPQELTITNKWFTPTKGYQITGMENPDAD
GVRVLREALPFSSSGLPIEISTLKSDDELMRRSGAYTIDIRPEGIRIEIVDGASLFYAAQ
TIRQLALKEDNGKYRLPECTIKDYPDVLFRGTVEGFYGQPWSHEDRIEQLRFYGKTKLNT
YIYGPKDDPYHSSPNWREPYPEDQARHITELAQEAARNKVNFVWAIHPGKDIQWNKTDSL
NILSKFEKMYDLGVRSFAVFFDDISGEGAKPQNQANLLNYIHNEFITKKKDVQPLIMCPT
EYNKGWAKTDYLDIIGEQLNPAIQVMWTGDRVVADIDKPGLDWVNQRIKRPAYIWWNFPV
SDYCQDHLLMGASYGLDTRAAGSMSGFVSNPMEYAEASKVAIFGVGMYTWNIDSYDPIRS
WKEACAFIMPEASEAFQTFCEHNADPGPNWHIYRRDESKAYIDAIERYKAAYAKANYDAE
AGRQLGALFAKITESSSELLDKCSNKNLLDEIRPWVIQFGYLGQAGTAAIETANAWANKD
LSATWENYLRTANMLDSIRFINTTMNQKAQPKGVKVGSRVLNPFLIELHHQTGRNLLATP
QVTADKVKMNIPTLLTDVEQLASQHYMEDGEIVGYPPMFETIRLNPGQYIGFNWEAQKEA
EYFHFNLPQSNREGRQFEWSADGVDWKKIKVSTESVRDTIRNIDPKARFIRMVNQSNQPL
DLNFRAFYAAMKKENVVDRKALTHDSNLDTYGELATGQIIKIDCQGINEIKLFTSGKGQI
TVTGIQGKKERPTLYKGNNGYIRISPKGCDKIEIQADGETRLHEIVKE

Enzyme Prediction     

No EC number prediction in MGYG000001898_01002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	150	440	9.6e-113	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.22e-166	150	439	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	1.00e-15	27	143	2	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
COG3525	Chb	4.00e-05	93	179	205	296	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT95333.1	0.0	1	828	1	837
AST53562.1	0.0	1	828	1	837
QUT54259.1	0.0	1	828	1	837
QUT18960.1	0.0	1	828	1	837
QKH97468.1	0.0	1	828	1	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	2.22e-187	1	734	1	737	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
5MI4_A	2.28e-187	28	734	15	727	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	3.53e-187	22	734	1	719	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2J4G_A	4.39e-187	28	734	3	715	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	4.53e-187	28	734	4	716	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.22e-186	1	734	1	737	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	4.78e-93	23	770	40	802	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	6.62e-93	23	770	40	802	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	4.68e-51	111	713	149	777	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	1.19e-37	151	419	63	340	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001366	0.249142	0.748143	0.000719	0.000397	0.000225

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001898_01002.