CAZyme Information: MGYG000001898_01415

Basic Information

• Species: Parabacteroides sp900552415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552415
• CAZyme ID: MGYG000001898_01415
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585		65466.4	4.7851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001898	3107743	MAG	Denmark	Europe

• Gene Location: Start: 5468; End: 7225 Strand: +

Full Sequence      

MRTLFFLLSLLWISGLSAQQRDSRTREYLPPVRIVWQQDSALIRGSENLLQPGNGQSDLS
NLKICKMSSTDQSHPAILLDFGRELQGGLQLVTGMPESHEPIAVRIRFGESASEAMCEID
GANGATNDHAMRDFVIRLPWLGVLEVGNTGFRFVRIDLVDDSAELCLKEIRAISTFRDIP
YRGSFRCNDERLNEIWRTGAYTVHLNMQEYLWDGVKRDRLVWVGDLHPEVMTVNSVFGYN
EVVPKSLDLARDITPLPGWMNGISSYSIWWLLIQRDWYYYQGDLDYLENQKAYLTALLRH
LISKVGADGVERLDGNRFLDWPSNANPAAINAGLQALMVRAMKAGSELCEVLGERELANE
CQTVMRRMIEAAPKVTEPLFTSGVAPDAPGSKQAAALLALSGLMDPVEADRRYLSVNGAK
GFSTFYGYYMLRAMAAAGNYEGALDRIRQYWGAMLDLGATTFWEDFDLDWLPGAAPIDEL
VPAGMRDIHGEFGAYCYKGFRHSLCHGWASGPTSWLSEYVLGIQVVEPGCRVVRIEPHLG
DLAWVEGTFPTPYGEIKVRHEKGEDGEVRSHVNAPDEITILGVDD

Enzyme Prediction     

No EC number prediction in MGYG000001898_01415.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	76	579	1.2e-103	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.64e-16	183	520	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	8.26e-08	522	575	1	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48045.1	0.0	1	581	1	582
QUR50485.1	0.0	16	580	17	580
QUT19201.1	0.0	16	580	17	580
BBK91321.1	0.0	16	580	17	580
QIX67104.1	0.0	16	580	17	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.88e-47	67	558	184	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.64e-20	21	521	47	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000205	0.999222	0.000144	0.000144	0.000129	0.000124

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001898_01415.