CAZyme Information: MGYG000001898_02086

Basic Information

• Species: Parabacteroides sp900552415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552415
• CAZyme ID: MGYG000001898_02086
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
624	MGYG000001898_89|CGC1	71409.1	6.2085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001898	3107743	MAG	Denmark	Europe

• Gene Location: Start: 2868; End: 4742 Strand: -

Full Sequence      

MKITKFWLTLNLFIFTTGASAQVVNPHLESIQIEGYVGERIQTCIDKRVKGQDVNELIEP
FRHLTEGNRWQSEFFGKWLLGAIASYRYSTDHELFRIIQNSVEDFIQTQHPDGYIGNYKP
EDRLTNWDIWGRKYSALALLDYYRLTNDKKALEAARRSIDCLMDELAEHNVDIATTGNYL
GMASCSILEPVVYLYQATRDDRYLNFAKEIVNGMEKTGSSRLISQALQDFPVSQRSPFPK
QWWSFDNGQKAYEMMSCYEGLIELGKELDDPLFLEAARKTADHILKEEINIAGSGAAFEC
WYGGKALQTIPAYHTMETCVTFTWMQFCARLLRETANPLYAEEFERTMYNALMASMKDDG
TQISKYSPLEGRRQPGEKQCGMRINCCNANGPRGFALIPSVAYQSEEDHLFVNLYLPSKA
TIKLGNRNKVTLTSHTQYPLDGKVELKLEPQKSSIFALALRIPSWADDNYEVNVNGEQQK
ALCRGSYLTIKRTWKKGDLVTIDFKPKARVIEQNHAQAVIYGPLVFARDTRFHDGDVDEC
AIIQCDRQGYVNTTPESASASFAWITLKVPMVLGTDLENEENKAVKIINFCDFASAGNDW
RPEGRYRIWIPKTLHVMSEPYHRY

Enzyme Prediction     

No EC number prediction in MGYG000001898_02086.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	66	526	5.3e-60	0.9064885496183206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	6.22e-63	70	527	55	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.61e-55	58	527	51	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	2.00e-06	136	212	149	232	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd04792	LanM-like	3.34e-05	136	286	500	626	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
COG1331	YyaL	8.18e-05	124	310	409	596	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	0.0	1	624	1	620
ASV73688.1	7.08e-43	28	533	42	526
BCA52128.1	1.13e-36	81	613	88	634
ANY73898.1	1.74e-36	44	530	41	566
AII67299.1	2.86e-36	81	613	102	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	7.79e-35	65	533	62	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	3.61e-28	21	530	34	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	1.28e-27	44	526	41	559	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.21e-25	44	526	41	559	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	3.88e-24	317	530	337	563	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000202	0.999248	0.000142	0.000144	0.000129	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001898_02086.