CAZyme Information: MGYG000001900_00682

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000001900_00682
• CAZy Family: CBM50
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
156		17569.27	11.7685

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001900	1885056	MAG	Denmark	Europe

• Gene Location: Start: 58960; End: 59430 Strand: -

Full Sequence      

MTEDEVRAANKIPKNRRVQVGSTILVKDAHASQDIQVAEADSAMRLVPLPTTRRITYRVR
SGDTLSGIAARFGVKAADIRKQNRLKSNTIKVGQRLHLTVREVQRAGLRKTAYRVKRGDT
LYTIAQRHRTSVSAIMDENHLQTKDLKPGQRLVIPH

Enzyme Prediction     

No EC number prediction in MGYG000001900_00682.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	113	155	4.2e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	8.10e-25	24	152	308	444	membrane-bound lytic murein transglycosylase D; Provisional
pfam01476	LysM	1.68e-16	113	155	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
pfam01476	LysM	7.13e-14	57	96	1	40	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd00118	LysM	5.43e-13	55	96	1	43	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd00118	LysM	6.52e-13	113	154	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS89247.1	2.39e-31	1	155	360	527
BBF22593.1	5.86e-31	1	155	340	505
QDA55156.1	6.53e-29	1	155	352	521
ANU65188.1	1.31e-22	1	154	336	506
QQQ96345.1	1.31e-22	1	154	336	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MKX_A	8.98e-06	57	96	7	46	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.59e-13	24	154	305	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.59e-13	24	154	305	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0C2T5	1.36e-12	56	154	244	362	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	3.45e-12	56	154	244	362	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	5.55e-11	56	154	242	364	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001900_00682.