CAZyme Information: MGYG000001900_00766

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000001900_00766
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		35710.31	8.775

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001900	1885056	MAG	Denmark	Europe

• Gene Location: Start: 46290; End: 47255 Strand: +

Full Sequence      

MTRRALIVKTTSMGDVIHALPAVADLAKAQPDLQIDWVVERSFADIPRLSRYVNTVHEVA
VRQWRKHVLSSQTWKEVGRVRAALQLAHYERVVDLQGLLKSAVIGRWSQSFLLGYDKNSI
KEPWACRFYDQTFSVSKSLSAVTRCRMLMGAAFDYDFKAYPLDFGLRTIEVCRDTSPYAV
FLVNTSRETKLWPENKWVALAKDCHQAGLSIRLLWGSEAEHERVKRIASLAGDFCQVLPR
MSIKDCAEVLQQAVFVVGVDTGLTHLAAATQRPTVGLFLDYPIELVGLTGACVKSLGGVG
ANPAVSEVKSALTQLGLDLFQ

Enzyme Prediction     

No EC number prediction in MGYG000001900_00766.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	80	278	2.8e-31	0.7955555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02193	heptsyl_trn_I	2.70e-119	4	316	1	319	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10964	PRK10964	8.34e-88	4	278	2	279	lipopolysaccharide heptosyltransferase RfaC.
COG0859	RfaF	1.83e-57	3	284	2	283	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	5.93e-42	77	278	1	209	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03789	GT9_LPS_heptosyltransferase	1.97e-39	4	278	1	222	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU66485.1	2.82e-82	6	315	4	313
QQQ97633.1	2.82e-82	6	315	4	313
QRJ64080.1	4.39e-82	4	308	2	308
ASJ22846.1	4.39e-82	4	314	3	315
ABE49021.1	1.50e-81	4	315	6	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	5.97e-59	4	287	2	288	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	5.97e-59	4	287	2	288	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	7.43e-59	4	287	2	288	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26469	2.29e-59	4	287	2	288	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
P24173	2.69e-58	4	287	2	288	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001900_00766.