CAZyme Information: MGYG000001902_00310

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; UMGS1810; UMGS1810; UMGS1810
• CAZyme ID: MGYG000001902_00310
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222	MGYG000001902_5|CGC1	25107.8	8.5603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001902	1713632	MAG	Denmark	Europe

• Gene Location: Start: 44412; End: 45080 Strand: +

Full Sequence      

MKTSDNGIALIKQFEGVRLTAYKAIPEEPYYTIGYGHYGADVSKGMTITQAQADAYLKTD
LIRYENAVKNTVKIPLNQHQFDALVSFTYNCGGNSLKSLVSGRTARQIAEKLPSYCYASG
RKLEGLIRRRKAEKELFMKEDDIDMDKYTELKQMIVNLQAQIESLKPTYYDWTTACPEWA
QPYVHTALVKGIIKGDEQGRLRLTDDKISNLVVAMRATGIME

Enzyme Prediction     

No EC number prediction in MGYG000001902_00310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	4	133	1.1e-38	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	3.03e-58	7	137	1	135	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	5.15e-38	1	142	5	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	1.45e-32	8	138	9	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	cd16901	8.15e-27	3	138	2	140	lyz_P1 P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	1.50e-17	30	131	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS48534.1	4.58e-49	2	137	4	138
BAK99222.1	3.19e-48	3	139	11	151
AOZ91616.1	3.68e-48	2	169	4	171
QKS43439.1	5.21e-48	2	148	4	154
QDY81941.1	2.06e-42	2	141	3	146

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	2.30e-23	3	139	52	195	ChainA, Lysozyme [Acinetobacter baumannii]
2ANV_A	1.99e-17	1	138	2	145	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
6H9D_A	5.84e-17	2	138	5	147	ChainA, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
7M5I_A	1.51e-15	1	92	7	99	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P62692	1.15e-32	1	139	1	138	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1
P62693	1.15e-32	1	139	1	138	Endolysin OS=Lactococcus phage phivML3 OX=10746 GN=L3 PE=3 SV=1
P11187	4.95e-32	1	137	1	142	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
P07540	9.78e-32	1	137	1	142	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
Q37896	3.52e-29	1	138	1	143	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001902_00310.