CAZyme Information: MGYG000001903_01223

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Firm-18
• CAZyme ID: MGYG000001903_01223
• CAZy Family: GH88
• CAZyme Description: Unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000001903_121|CGC1	42754	5.4071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001903	2217690	MAG	Denmark	Europe

• Gene Location: Start: 3415; End: 4542 Strand: +

Full Sequence      

MEILTKQQIDELWNKIDKKLARVAISAREKLPYTTIDGVYDDHSHEGADGVDWWTNGFWA
GMMWLMYAGTKNEEYKITARRSEELLDKALLAPQKLYHDVGFMWQLSSSADYQLTKNQKS
FERSLAAANTLAGRYNVRGGYIRAWNGNGNEGSAIIDCMMNLPILYWASDAIGDDRYRYI
AMNHADKTMANHVRPDGSVNHILHYYPENGEIEENIGGQGYCEGSSWSRGQAWGLYGFTL
SYIHTKEQRYLDTAKKIANYFIAACCDDYLPRCDFRAPAQPVIYDSSAGLIAACGLLELS
KLVGEYEKDMYYNAACRFVKAAAENFTDWSDETDAIITHGTEAYHADRHHIAMIYSDFYF
VEAVNKLKGFNTFLW

Enzyme Prediction     

No EC number prediction in MGYG000001903_01223.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	51	366	8e-106	0.9787234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.79e-10	54	268	29	235	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ47284.1	1.55e-138	9	375	10	385
AIQ52827.1	4.41e-138	9	375	10	385
QNK59727.1	4.90e-137	6	375	7	384
QLG40538.1	1.35e-134	9	375	11	385
QKS45234.1	1.79e-134	9	375	10	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VD5_A	1.25e-60	49	375	38	372	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	6.88e-60	49	375	38	372	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	3.94e-51	3	364	22	386	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.03e-51	3	364	23	387	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	2.18e-50	3	364	23	387	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RC92	6.84e-60	49	375	38	372	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8DR77	1.87e-52	3	373	21	395	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	1.61e-50	42	373	59	398	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	2.21e-50	3	364	23	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
T2KLZ3	8.93e-33	54	369	77	396	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998878	0.001049	0.000038	0.000002	0.000002	0.000031

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001903_01223.